Q: 5
A: Recombinant forms of Oestrogen and Progesterone are used in post menopausal women. Recombinant insul...
Q: expalin how theory of evolution affects our view of the origin, developtment and spread of new disea...
A: The theory of evolution is based on the idea that all species are linked and evolve through time. Th...
Q: Which of the following IS NOT part of the goals of acute stress response to increase rate of skeleta...
A: The acute stress response is the set of events that takes place when the body encounters a stressful...
Q: how does an organism maintains homeostasis through the interaction of the various organ systems in t...
A: Homeostasis, from the Greek words for "same" and "steady," refers to a self-regulating process by wh...
Q: 10. What is Relative Centrifugal Field (RCF, in g's) in a centrifuge with a rotor radius of 10 cm sp...
A:
Q: When surface barriers protecting the body are breached, the second line of defense (of the innate im...
A: Inflammation is a normal physiological response of the body to damage caused to tissue. Infection co...
Q: A trait that is exclusive to a group of animals but different from what their ancestor had is called...
A: Traits are evolved for many reasons including the survival, reproduction, food availability and many...
Q: Four E. coli strains of genotype a*b¯ are labeled 1, 2, 3, and 4. Four strains of genotype a¯b* are ...
A: ANSWER;- HFR is the high-frequency recombination cell F+ is the donor cell whereas F- is the recipi...
Q: What is biology
A: Biology deals with living organisms and their various processes. It is a natural science discipline.
Q: Why did Gregor Mendel choose pea plants as his experimental organism?
A: It was during the mid-nineteenth century thas headway was made in the understanding otl inheritance....
Q: H* ions generated by reactions in the electron transport chain, as well as H* ions present in the ma...
A: The electron transport chain is a series of reaction in four protein complexes, taht creating an el...
Q: What factor could have been responsible for the changes in the population's age structure? Use the s...
A: The population age structure of a country or region is the distribution of its people's ages. This c...
Q: 3. What would be the optimum pH for pepsin, an enzyme that breaks down protein in your stomach? Why?
A: ANSWER) The optimum pH for enzyme Pepsin is 2. At 2 pH Pepsin exhibits maximal activity.
Q: Identify the parts of the heterotrimeric G-protein shown in the image. B
A: Introduction :- G proteins, also known as guanine nucleotide-binding proteins, are a group of protei...
Q: Ebola virus kills 90% of the people infected. In an infected individual, how many copies of Ebola Vi...
A: The usual concentration of Ebola in patient's blood is 5-10 X 106 virus particles/ mm3. Major organs...
Q: Aside from Dengue Fever what other diseases can Aedes aegypti carry? Give 3
A: Classification Kingdom : Animalia Phylum. : Arthropoda Class. : Insecta Order. : Dipter...
Q: trace a glucose molecule from starch sitting in the small intestine to a body cell. What is the role...
A: A transepithelial transport mechanism, begun at the apical membrane by the cotransporter SGLT-1, tra...
Q: If the true inheritance pattern was a normal Mendelian dihybrid cross, it would be more likely to re...
A: * Mendels dihybrid cross : *Dihybrid cross means crossing between two different genes that has two...
Q: A pentapeptide was found to increase the rate of hydrolysis of fats in the adipose tissues to provid...
A: *Electrophoresis is a technique used to separate genetic materials like DNA and RNA and protein bas...
Q: Importance of Avocado sunblotch viroid
A: Avocado sunblotch is a viral infection caused by the avocado sunblotch virus (ASBVd). ASBVd is the t...
Q: Dopamine is an inhibitory neurotransmitter released into neuromuscular synapses Patients with Parkin...
A: Parkinson disease is a disease of central nervous system. Currently there is no cure of disease.
Q: 22
A: Motor neurons are components of peripheral nervous system which conduct efferent impulses from the s...
Q: 1. define inheritance, genes, alleles, and other basic terms used in genetics. 2. execute the basic...
A: It was during the mid-nineteenth century that headway was made in the understanding of inheritance. ...
Q: How does crossing over shuffle alleles?
A: The meiosis is a cell division process that involves division of a diploid (2n) mother cell and prod...
Q: some people may argue that evolution is simply a theory. how will you defend the theory of evolution...
A: In biology , the evolution is the change in the characteristics of species over several generations ...
Q: What is an aliquot? Give two uses of serial dilution.
A: Introduction: Serial dilution is a series of repeated dilution performed on the same solution to cha...
Q: how the theory of evolution affects ours view of origin,developtment and spread of new diseases such...
A: Theory of natural selection stated that the survival of the fittest is the ultimate driving force fo...
Q: How can a large amount of biological diversity protect an ecosystem from environmental damage? Why a...
A: Introduction In this question we will discuss about how large amount of biological diversity can pro...
Q: Human Karyotype B (questions #7 to #12) 7. The diploid number is 46. 8. The haploid number is 23 onl...
A: Karyotype: A karyotype is a collection of all metaphase chromosomes in a species' or individual orga...
Q: Hello, good day. I have a problem answering this question, and I need your help. Hoping for a respon...
A: Flies belong to the order Diptera, which has evolved advanced mechanosensory organs known as haltere...
Q: 0. In humans, dark hair (D) is dominant over blondness (d), and color blindness (c) is a sex-linked ...
A: Color blindness is typically an inherited genetic condition in which individuals have a decreased ab...
Q: Outline five (5) Biomedical Engineering devices and their applications
A: There are few important points about Biomedical engineering are as follows: It is a field in which ...
Q: answer the question. The bombardier beetle is spraying a boiling hot liquid that contains irritating...
A: Introduction: Beetle is considered to be the gardener's friend and it is a fearsome predator as it c...
Q: Mycobacteria tuberculosis and Rickettsia
A: Mycobacterium tuberculosis is a pathogenic that bacteria from the family Mycobacteriaceae and the ca...
Q: What is ammensalim?
A: In the ecosystem each and every species interact with each other and exhibit in a relationship. Amen...
Q: why are gram-negative bacteria unevenly distributed on a slide?
A: why are gram-negative bacteria unevenly distributed on a slide?. Introduction: Bacteria that do no...
Q: What is Known as photosynthesis?
A: Green plants (autotrophs) are the manufacturers of organic compounds. They are the producers in the ...
Q: Aside from skin (an organ), what other structures are in the integumentary system of other animals a...
A: The integumentary system is composed of organs and systems that shield the internal body from harsh ...
Q: Which of the following is an example of viral species? a. Flavivirus O b. None of the choices human ...
A: Introduction : Viral species : " a monophyletic group of viruses whose properties can be disting...
Q: 1. b. What is the sequence of the mRNA produced from this gene? Label the 5' and 3' ends 5' GAGCCAUG...
A: Gene is a hereditary units that are involved in sending hereditary instructions from parents to offs...
Q: Primer designing: A single-stranded DNA sequence (963 nucleotides) that codes for a hypothetical pro...
A: ANSWER;- Forward primer:Sequence = 5'-CT-GAATTC-ATGGCTAAAGGCGGAGCT-3'Length = 18 ntdGC content = 56...
Q: What are the Rule of Independent Events, the Product Rule, and the Sum Rule. Define single nucleotid...
A: These rules are used in biology to classify events and explain the difference in various events SNP...
Q: What are the advantages of storing food as fat rather than carb or protein? b) What is the formal de...
A: Introduction:- Vitamins and minerals are micronutrients that the body requires. These nutrients have...
Q: _1. It is the important organ that controls thought, memory, emotion, touch, motor skills, vision, b...
A:
Q: asystole
A: The cardiac cycle is the performance of the human heart from the beginning of one heartbeat to the b...
Q: What is the climax stage of an ecological succession?
A: Introduction In this question we will discuss about the climax stage of an ecological succession.
Q: Which of the following statements about the differential expression of human genes is correct?
A: There are three postulates of differential gene expression, two of which states that - 1. Every nuc...
Q: A new intestinal isolate of E. coli is known to have a generation time of 12 minutes. If a culture c...
A: generation time is the time required by bacteria to multiply and become double. bacteria has genera...
Q: Which of the following statements about the lac operon is correct? 1. lacZ, lacY and lacA proteins a...
A: Introduction : Lac Operon - Regulatory gene is Lac I . Structural genes are lacZ, lacY and lacA. ...
Q: (d) Given below is an apparatus used to study a particular process in plants. Study the same and ans...
A: (i) Ganong's Potometer. (ii) Because not all of the water taken up by the plant is used for transpir...
Step by step
Solved in 2 steps
- III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…What Art the Features of the Series of -omes? Define the following terms: a. Genome b. Transcriptome c. Proteome d. Metabolome e. FluxomesmolA eno DNA -- THE DOUBLE HELIX (modified from The Biology Corner - Worksheets and Lessons) The nucleus is a small spherical, dense body in a cell. It is called the "control center" because it controls all the activities of the cell. Chromosomes, found in the nucleus, are microscopic, threadlike strands composed of the chemical DNA (short for deoxyribonucleic acid). Chromosomes are composed of genes, which is a segment of DNA that codes for a particular protein which in turn codes for a trait. It is commonly referred to as the gene for baldness or the gene for blue eyes. In 1953, James Watson and Francis Crick established the structure of DNA. The shape of DNA is a double helix, which is like a twisted ladder. The sides of the ladder are made of alternating sugar and phosphate molecules. The sugar is deoxyribose. Color all the phosphates red (labeled with a "p"). Color all the deoxyriboses blue (labeled with a "D"). The rungs of the ladder are pairs of 4 types of nitrogen bases. The…
- Numbering the fragments left by cutting the DNA with BAM HI from left to right, which fragment will travel the furthest? BAM HI: GGATCC CCTAGG AATCGGATCCATTTGGACTAAAGGACCCGGATTGGATCCAGGGCCTTTAGTACC TTAGCCTAGGTAAACCTGATTTCCTGGGCCTAACCTAGGTCCCGGAAATCATGG O 3 O 2 4. 1.me Insert Design at Painter 278 words Calibri Layout 11.5A A Aa BIU-abe X₂ X² A--A- ype here to search Font W Unique Unigriffin DNA: mRNA: amino acids: traits: DNA: mRNA: amino acids: traits: DNA: mRNA: amino acids: traits: References # M 3 How DNA Determines Traits- Transcription and Translation Fill in easier type.pptx part 2 - Word Tell me what you want to do... Mailings Review View A-6-5- LLI Paragraph | CAG TCG TTT | ATG GGG CTT CTT TIT | GAG AAT TCA CGC I S4 | CGA CAA CAC | GTA GTA | CAA AAA ATG | TTA TAG AAT GAC GGG TGG | wwwwww O 2 A W R =-- | TTA TTG TTA CGG | AAA AGA CCT | GCA GCC TTG TGT | de in ACROBAT % 5 ¶ T 1 Normal AaBbCcDc AaBbCcl AaBbCcL AaBbCcDc AaBbCcDc AaBbCc[ AaBbCcD Aal 1 Body Text 1 List Para... 1 No Spac... 1 Table Par... Heading 1 1 Heading 2 Hea Styles Y 7 OM O 38°F JACQUI 10 LBelow is a sequence of DNA. 5'-ttaccgataattctctctcccctcttccatgattctgattaaagaaggcgagaacgaaactatttgttaatacc-3' Using the one letter code for Amino Acids, what is the predicted AA sequence of the shortest ORF (from N to C-terminal end)? Using the one letter code for Amino Acids, what is the predicted AA sequence of the longest ORF (from N to C-terminal end)?
- COMPLEMENTARY DNA SEQUENCE OF GACGGCTTAAGATGCTable I CACGT A GA CTGAGG ACTC CACGTAGACTGAG G ACAC Wild-type beta-globin gene fragment Sickle-cell beta-globin gene fragment > Circle the mutation in DNA of the sickle-cell beta-globin gene fragment Compare fragments of DNA the wild-type and mutant beta-globin genes in the Table I above, what are the similarities and differences you observe?6. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…
- 1_30*_SP23 - General Biology I (for majors)/1 of us page The anticodon sequence created from the following DNA: TACGGGGCTGAGATT F1 Select one: O a. Tyr-Gly-Ala-Glu-lle O b. AUGCCCCGACUCUAA c. UACGGGGCUGAGAUU O d. Met-Pro-Arg-Leu-STOP F2 # 80 F3 $ 000 000 F4 % F5 MacBook Air F6 & r F7 DII F8What is the melting temp. of the following double-stranded DNA fragment CATCGCGATCTGCAATTACGACGATAA GTAGCGCTAGACGTTAATGCTGCTATTGenetics Attached is a segment of DNA (doublestranded). Answer the following questions about the segment of DNA: How many open reading frames (ORF) are in this sequence? How many amino acids are encoded in all open reading frames in this segment/sequence? Which strand is the template strand for the longest open reading frame?