Write Dotplot alghorithm for finding inversions between the following DNAs in Python. Sequence 1: 5' - GCTAGGACCTTGATAGAACCATGCATGCATGCATGCAGTCTGGTCACTATGCCGTC - 3' Sequence 2: 5' - TACGTATCGGCGTTAGCGTAGCATGCATGCATGCATCGATGCCTAACGTTCTAAGC - 3'
Q: In the Avery, McLeod, McCarty Experiment where supernatant from heat killed, virulent S Strain…
A: Avery, McLeod and McCarty experiment was used to determine the genetic material and its nature on an…
Q: In a random sequence consisting of equal proportions of all four nucleotides, what is the average…
A: Restriction enzymes are natural occurring enzymes which are mainly found in prokaryotic organisms. A…
Q: From the following choices, select the DNA sequence that is classified as a mirror repeat. ATCATC O…
A: DNA or deoxyribonucleic acid is the genetic material in living organisms that is composed of…
Q: natural selection, genetic drift, and gene flow.
A: Evolution:It is defined as the process of change in the inherited characteristics of biological…
Q: Sister chromatids normally separate during which of the following phases of division? a…
A: Just prior to mitosis, each chromosome duplicates to form sister chromatidsSister chromatids are…
Q: Give a full discerption of luminescence and fluorescence. Then in short sentence what is the…
A: Luminescence and fluorescence are phenomena that are related to the emission of light from certain…
Q: Write a summary for this article…
A: This article on climate change in the US was published nine years ago 2014.In this article, it…
Q: Eat eggs and exercise to live longer! ” Obviously, this ‘headline’ is fictitious, but it got your…
A: This article leaves many unanswered questions that hightlights further need of informations
Q: A cell that produces a lot of _________ would have a lot of ribosomes.
A: The number of ribosomes within a cell may vary depending on cellular requirements, growth…
Q: Imagine strong directional selection is applied, favoring large values of this trait. After one…
A: In the given scenario, we are presented with two graphs (A) representing the relationship between…
Q: Consider the expression of HOX genes in a wild type embryo. Predict the pattern of HOX gene…
A: In the study of HOX gene expression in embryos, it is important to consider the impact of specific…
Q: ATP is used by the cell to perform work. O True O False Question 91 lonic bonds in compounds are…
A: All living things depend on nucleic acids, proteins, lipids, and carbohydrates as the basic…
Q: What effect would a continuous supply of exogenous estrogen or progesterone have on an adult female…
A: Estrogen and progesterone are two hormones that play important roles in the female reproductive…
Q: Would one expect to see any cyanobacteria cells dividing by mitosis or meiosis? Why?
A: Cyanobacteria, also known as blue-green algae, are prokaryotic organisms that belong to the domain…
Q: The results of a test cross of a plant that is heterozygous for three traits encoded by the genes D,…
A: Physical mapping is used to find the order of genes and the distance between genes in the DNA…
Q: Which of the following parameters should be altered to increase the amount of vector-insert…
A: In molecular biology research, ligation is a fundamental technique used to join DNA fragments…
Q: 4- a) b) data How can bioinformatics tools be used to study posttranslational modifications? By…
A: The area of bioinformatics, which combines the study of biology, information technology, and…
Q: The sequence below is a template strand sequence for a gene (a very short one!). Identify the start…
A: The reading frame is determined by the start codon, which is typically AUG (encoding methionine) in…
Q: All of the following are characteristics of epithelial tissue EXCEPT: contains matrix avascularity…
A: It is composed of cells laid together in sheets with the cells tightly connected to one another.It…
Q: Draw an oxygen-hemoglobin dissociation curve. Put in the points that represent systemic venous and…
A: A graph that shows the connection between the partial pressure of oxygen (PO2) and the saturation of…
Q: outline the Danger, Response, Airway, Breathing and Circulation (DRABC) Model and make it relevant…
A: The DRABC model is a widely recognized framework used to assess and manage emergencies. When applied…
Q: 1st Bag: shredded wheat original cereal, Warm water, and yeast (no sugar) 2nd Bag: Cinamon Toast…
A: Fermentation is a fundamental biological process that has been harnessed by humans for centuries to…
Q: signal transduction pathway for auxin
A: This pathway refers to a series of molecular events which transmit a signal from the extracellular…
Q: Question 10 Which of the following membrane transport methods requires ATP molecules to work? A…
A: Membrane is the outer covering of cell. It acts as a barrier between extracellular and intracellular…
Q: What are the different Pre-zygotic and Post-Zygotic Reproductive Barriers?
A: Acvording to our guideline we can answer only the first question with three subparts. You hava…
Q: The following is a high-risk area. Discuss the opportunities for the risk management team to help…
A: Surgery and anesthesia. They can be unsafe since they're exceptionally complicated and the…
Q: A turkey farmer is worried about a new disease that is found in his birds. If affects females more…
A: It is given that A disease is found in turkeys Disease predominantly affects female turkeys than…
Q: I II III 2 1 2 3 3 5 2 6 7 What is the most probable genotypes of individuals 1-1? What is the most…
A: Pedigree charts are family trees that show the members of a family who have been affected by genetic…
Q: Define parsimony. How is it used to build phylogenetic trees?
A: The scientific study of phylogeny is known as phylogenetics.Phylogenetic tree is a branching…
Q: Activators bind to genes at enhancer sequences and increase transcription. ACTIVATORS ACTIVATOR…
A: In eukaryotes, transcription is a complicated process that is regulated by a number of variables to…
Q: In a lake, the _________ has the lowest temperature.
A: The hypolimnion is the deepest layer of water in a stratified lake located below the thermocline. In…
Q: Task #3: Design primers agagtctcct cagacgccga gatgctggtc atggcgcccc gaaccgtcct cctgctgctc 61…
A: In molecular biology and genetic research, the design of primers and the incorporation of…
Q: The nuclear envelope of a cell is a phospholipid, bi-layered structure surrounding eukaryotic…
A: Eukaryotes are organisms with a nucleus that is enclosed in a nuclear envelope. Other membrane-bound…
Q: bronchial tree
A: It is a complex network of organs, tissues and structures which are involved in the process of…
Q: If one side of the helix is CACTGGACTGTG, the complementary side would be??
A: There are two types of nucleic acids present in our body, DNA and RNA. DNA is the genetic material…
Q: What a cell or tissue will normally develop into during development A. Cell Fate B. Competence C.…
A: Cells and tissues go through a number of complex processes during development that ultimately result…
Q: Canadian sources only (please no U.S. as regulations are different). Answer in your own words and…
A: Food spoilage refers to the process by which food becomes unfit for consumption due to various…
Q: Make a quick list of four dishes, of which one is made with vegetables that you had for your meal…
A: Salad (made with vegetables)Grilled chickenRice pilafGlass of red wine (alcohol after the…
Q: 7. What is the reflex? Give one example and explain how it helps protect your body
A: Reflexes are an important part of our life. These are actions that occur without putting any thought…
Q: Brief description of Keto Diet. Will this diet provide the body with all the micro and…
A: The Keto diet or the Ketogenic diet, is a high fat, adequate protein and low carbohydrate diet. This…
Q: Diversity: Who is/isn’t represented when we discuss chronic diseases, and what can we do about it?…
A: “Since you have posted a question with multiple sub parts, we will provide the solution only to the…
Q: R-S? E-P? E-S? L-B? X-L? R-X? P-B? X-B? [Choose ] [Choose ] [Choose ] [Choose ] [Choose ] [Choose ]…
A: There are a following few important terms.Linked genes: When two or more genes reside on the same…
Q: Describe the issues associated with drug safety after FDA approval
A: FDA stands for food and drug administration, is a government agency, formed in 1906. This agency is…
Q: %OM pH EC Ca2+ Mg2+ K+ Na+ Al3+ H+ % dS/m cmolc/kg soil cmolc/kg soil cmolc/kg soil cmolc/kg soil…
A: In the field of soil science, understanding the quality and composition of soil is essential for…
Q: vestibule and of semicircular canals 6. What is adaptation? Give one example of body's capacity for…
A: Adaptation is a fundamental process through which organisms adjust and respond to changes in their…
Q: please list and explain some of the best ways to test for renal function?
A: A pair of kidney is present in our body. Kidney is one of the important organs of our body and it…
Q: Which of the following tools should be used in identifying a mutation in a sequence compared to a…
A: Gene mutations, and alterations in the DNA sequence, play a fundamental role in shaping life and…
Q: Producers or Primary Producers: Also called ________________, make their own food by extracting…
A: As per the guidelines of Bartleby,"Since you have posted multiple questions, we will provide the…
Q: you did a serial dilution experiment to determine the CFU/table of the Equate Children's…
A: The count for bacteria is done by counting the number of colonies on a culture plate when a known…
Q: Investigations of the microbiome have become an important part of research efforts in human health…
A: To investigate the relevance of the oral microbiome in tooth decay, the following approach can be…
Step by step
Solved in 3 steps
- Below is a sequence of DNA. 5'-ttaccgataattctctctcccctcttccatgattctgattaaagaaggcgagaacgaaactatttgttaatacc-3' Using the one letter code for Amino Acids, what is the predicted AA sequence of the shortest ORF (from N to C-terminal end)? Using the one letter code for Amino Acids, what is the predicted AA sequence of the longest ORF (from N to C-terminal end)?Design a pair of primers to amplify the entire length of the following 45 base pair sequence.Make each primer 14 bases long. Write the sequences of the primers in 5' to 3' order.(Hint: It will help for you to write out BOTH strands of the DNA sequence listed below.5'-GATGCCCGTTGGATAAATTGGGCGTCTAGAATCGGTCACACTTAG-3'Examine the following DNA sequence (only one strand is shown). The shown strand will be referred to as Strand 1. The complementary strand will be referred to as Strand 2: 5’ TTTAAGCCGTACCGATATAATGTAAGGCGAGCTTGACCGTCTTGGGCATCATA 3’ There is an eleven (11) base pair sequence that serves as a replication origin. Write below the most likely 11 nucleotides on this strand that serve as the replication origin. Think carefully about base pairing.
- In a standard procedire, when writing and reading base sequences for nucleic acids (both DNA and RNAs) always to specify base sequence in 5' > 3' direction unless otherwise directed 1. From the base sequence 5' A-T-G-C-C-A 3' in a DNA template strand, determine the base sequence in hnRNA synthesized from the DNA template strand 2. From the base sequence 5' T-A-A- C-C-T 3' in a DNA template strand, determine the base sequence in hnRNA synthesized from the DNA template strand5’-GATCAGCTGACTGGATCCGTCCTCAACGTCAGGATCCAGCTTCAAG-3’ 1. How many cuts do you expect this enzyme to make on the above DNA and how many fragments do you expect to see on your gel? Assume that they are all different sizes.The following DNA sequence was determined by Sanger sequencing, using a 20 nt long sequencing primer that ended ...AGTACAACAA-3'. 5'-agtacaacaa ctctcggtc tacggtacgc ctgcgggcgc gtagccaatc tagcacttcg-3' 3'-tcatgttgtt gagagccag atgccatgcg gacgcccgcg catcggttag atcgtgaagc-5′ A. If the technician forgot to add ddNTPs to the reaction, what would the sequencing chromatogram look like? Blank Many peaks, but only one at each position Overlapping peaks at every position All peaks are black There is only one peak, at 60 nt B.When the reaction is done correctly, ddCTP is labeld with a yellow fluorescent tag. When the Sanger sequencing reaction is complete, what will be the lengths, in nucleotides, of the three shortest products that have the yellow tag? C. Could you perform Illumina sequencing using ddNTPs? Why or why not? Explain.
- Assume the sequence below is one half of a double stranded DNA template used in a PCR reaction. The highlighted sequences indicate the region bound by primers, either on this strand or on the other complementary strand. 5' ACGTGCGACACGTATATATGTCGCGTGAGTGTAGCGTATCGCTAGAGACGCATACCTATG 3' If the sequence of the forward primer is 5' GCGACACG 3', which of the following sequences would represent the reverse primer? a. 5’ – CAGAGATCGC – 3’ b. None of these sequences would represent the reverse primer c. 5’ – GTCTCTAGCG – 3’ d. 5’ – GCGATCTCTG – 3’ e. 5’ – CGCTAGAGAC – 3’Given the DNA sequence of the restriction enzyme: gi|6329444|dbj|AB034757.1| Hynobius retardatus mRNA for larval beta-globin, complete cds GCAGAATCTGACTCAAGAAATCCCTCCTCACCCAACACCACCAGCAGCCATGGTTCACTGGACAGCAGAGGAGAAGGCAGCCATCAGCTCTGTGTGGAAGCAGGTGAACGTGGAGAGCGATGGACAGGAGGCCCTGGCCAGGTTGCTGATCGTCTACCCCTGGACCCAGAGATACTTCAGCTCTTTTGGGGACCTGTCGAGCCCAGCTGCCATTTGTGCCAACGCCAAGGTCCGTGCCCATGGCAAGAAGGTCCTGTCCGCCCTGGGAGCCGGCGCCAACCACCTGGATGACATCAAAGGCAACTTTGCTGATCTGAGCAAGCTTCACGCAGACACACTCCATGTGGACCCCAATAACTTCCTGCTCCTGGCAAACTGCCTGGTGATCGTCTTGGCCCGCAAGCTGGGAGCCGCCTTCAACCCTCAAGTCCATGCGGCCTGGGAGAAGTTCCTGGCCGTCTCCACCGCGGCTCTGTCCAGAAACTACCACTAGAGACTGGTCTTTGGGTTTAATTCTGTGAACGTCCCTGAGACAAATGATCTTTCAATGTGTAAACCTGTCATTACATCAATAAAGAGACATCTAACAAAAAAAAAAAAAAAAAAAAAAAAAA Identify two blunt-end cutters Identify two sticky-end cutters. For each, Provide the sequence of the Restriction enzyme, Highlight using a specific color where the DNA sequence where the restriction enzyme will cut the DNA Indicate the…In a genome project, the following genomic DNA sequences were obtained. Assemble the sequences into a contig. Using the assembled sequence, perform a BLASTn search. Does the search produce sequences similar to your assembled sequence? 5’ TCGGGGTCCTGGGATCTCATCACTGCAGCGC 3’ 5’ACTGCAGCGCTTTCCCAGCGGGCGGTGGTAC 3’ 5’GGGCGGTGGTACTCGGGAAGTCAGGAGTGTT 3’ 5’AGGAGTGTTTAAAACCTGGGGACTGGTTTTG 3’ 5’TGGTTTTGGGGGCGCTGAAGGCAGCGCAGGA 3’
- Using the first and second base key below, predict the DNA sequence given by the SOLID color sequence. For the key G = green, R = red, Y = yellow, and B = blue. Note that the first base of the sequence is already given ("A"). Give the remaining 8 bases for this sequence. A First base A CCT Second base A CGT BGY R GBRY RBG R Y (G) B Y G)(R) GB )( R )( Y ) ( G) BConsidering the number of base pairs, compute for the actual length (in micrometers) of this DNA model6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…