What would you predict about the ratio of hydrophilic to hydro- phobic amino acid residues in a series of monomeric globular proteins that range in size from a molecular weight of 10,000 g/mole to a molecular weight of 100,000 g/mole? Note that the volume of a sphere is 4/3nr³, while the sur- face area of the outside of a sphere is 4nr².
Q: Describe the structural basis for the cooperative (allosteric) binding of O2 by hemoglobin but not…
A: Both hemoglobin and myoglobin are oxygen transport proteins. Both of them are complex proteins…
Q: Which of the following statements is/are TRUE about the PPP? A. Most active in cells where…
A: Which of the following statements is/are TRUE about the PPP? A. Most active in cells where…
Q: What is the significance of acetyl-CoA to lipid metabolism?
A: The synthesis and breakdown of lipids in cells is known as lipid metabolism. It involves the storing…
Q: Hierarchical Organization of Protein Structure Q3.1 Describe the properties of an amphipathic alpha…
A: With increasing complexity, protein structures can be arranged into four categories of hierarchies.…
Q: Procedure used to prove that AZT is a competitive inhibitor of HIV reverse transcriptase.
A: AZT is a drug used for the treatment of HIV or to inhibit the replication of the HIV virus. Reverse…
Q: Discuss how the following buffer systems work in the human body: a) Carbonate buffer system b)…
A: All biological processes are pH dependent. Even a slight change in pH can result in a large change…
Q: Enzyme Triacylglycerol Lipase Rennin Catalase Hexokinase Enzyme Official Name (write N/A if…
A: Enzymes are usually comprise of proteins which work as a catalyst and increase the rate of reaction…
Q: Calculate the pH of a blood plasma sample with a total CO₂ concentration of 25.7 mM and bicarbonate…
A: The acid dissociation reaction taking place here is given below, where carbonic acid (H2CO3) gives…
Q: is albumin a macromolecule? if yes which type?
A: The biological macromolecules can be divided into four classes: the nucleic acids, the proteins, the…
Q: Intermediary metabolism includes all the reactions in an organism involved in generating and storing…
A: Metabolism is the total of all chemical transformation that takes place in a living cell. One…
Q: What is the major difference between motifs and domains? a) Motifs are unstable on their own, while…
A: Motifs and domains are the structural elements of proteins that differ in their organisation and…
Q: Mixtures of amino acids can be analyzed by first separating the mixture into its components through…
A: In ion exchange chromatography the column support matrix is constituted of beads to which charged…
Q: Predict the amino acid sequence based on the conditions below. Use the one-letter abbreviation of…
A: Amino acids are building block of polypeptide chain. its alpha carbon contains carboxyl group, amine…
Q: Predict the amino acid sequence based on the conditions below. Use the one-letter abbreviation of…
A: Amino acids are building block of polypeptide chain. its alpha carbon contains carboxyl group, amine…
Q: Which of the following is/are required in the amino acid activation by aminoacyl-tRNA synthetase?…
A:
Q: c) A lysine residue in the active site of UstD is involved in forming a covalent Schiff base linkage…
A: UstD is an enzyme that decarboxylates specific acidic amino acids and allows the transfer of the…
Q: How could nucleic acids have appeared without the enzymes that catalyze their synthesis?
A: Apart from the biological synthesis of the nucleic acids using a set of enzymes, the nucleic acid…
Q: In this FRET data table, an antibiotic was added, but the type was not recorded. According to the…
A: FRET (Förster resonance energy transfer) is a technique in which energy transfer between two…
Q: What ionization state of Glu35 and Asp52 side chain predominates at pH 1, 4, and 7?
A: Glutamate and Aspartate are negatively charged amino acid. At pH 7 Glu35 and Asp52 side chains have…
Q: Draw the Glycolysis (from glucose to two molecules of pyruvate) pathway and identify the different…
A: During glycolysis, one molecule of glucose results in formation of two pyruvate. Glucose is a…
Q: QUESTION 4 What was the distance (in cm) traveled by the SAMPLE B in the TLC below: solvent front…
A: TLC is a separation technique in which solutes or molecules are separated on the basis of their…
Q: 1. Amino acids as the structural components of proteins in the human body: the structure, isomerism…
A: Amino acids form polymers via condensation reaction of the amino group of one amino acid with a…
Q: if the helix is more stable in water, would there be a way to synthetically create base pairs in…
A: Double stranded DNA is composed of two complementary strands with each strand consisting of sugar…
Q: Draw the peptide SMILE @ pH = 5. What is the net charge? What is the PI?
A: A peptide is a sequence of amino acids that are joined together through peptide bonds. The…
Q: G-C A-T OT-A N-C C-G H N=C N-HO Which DNA base pair is represented in this figure? N-HIN HIN I H C-H
A: The monomeric units of DNA or deoxy nucleic acid are called nucleotides. Nucleotides are phosphate…
Q: Which of the following Fischer formulas is/are monosaccharide that has two chiral centers? Н Н Т Н-…
A: Carbohydrates are polyhydroxy aldehydes or ketones. They can be classified into monosaccharides,…
Q: Why is a string of bound amino acids called a polypeptide?
A: Greek sources give the term protein, meaning first or primary. The most numerous and varied…
Q: What does glutamic acid do to the membrane potentials of: Neurons - Muscles -
A: Glutamic Acid : It is an α amino acid which is used by all living beings & organisms in the…
Q: Substance that transports fatty acid from the interrnembrone space to the mitochondrial matrix? A.…
A: Long chain fatty acids must be transported into the mitochondrial matrix for beta oxidation. As they…
Q: Energy is stored long-term in the bonds of _____ and used short-term to perform work from a(n)…
A: A molecule is defined in chemistry as a grouping of distinct atoms. Water molecules (H2O) and carbon…
Q: How do you explain Mr Willis’ dark urine and dark stools? Would Mr Willis benefit from any…
A: G6PD(glucose-6-phosphate dehydrogenase) is an enzyme which helps in proper functioning of RBCs. Its…
Q: What typically is found in position X in the molecule below?
A: Nucleotides are molecules that have a nitrogenous base (Adenine, Thymine, Guanine, Cytosine and…
Q: In most cases the peptide bond is in the trans conformation. What statement below best explains this…
A: In proteins the adjacent amino acids are held together via peptide bonds . A peptide bond is an…
Q: Elaborate Please complete the table. Table 1. The Compounds and Elements in the Human Body Compounds…
A: Carbohydrates, proteins, fats and vitamins are essential nutrients that are important for proper…
Q: How can one confirm/investigate the type of inhibition exerted by AZT on the HIV reverse…
A: HIV stands for human immunodeficiency virus which causes AIDS and interferes with the body's ability…
Q: 1. Look for the meaning of the following words: • a. Pre-eclampsia Neurotransmitter . b. c.…
A: A neurotransmitter is a signaling mediator that is secreted by a neuron and can affect another…
Q: Of the components in the hydrogels beads, which is the protein we are interested in measuring?
A: Hydrogel beads are cross-linked mesh of hydrophilic polymers which is composed of spherical shaped…
Q: Each ionizable group of an amino acid can exist in one of two states, charged or neutral. The…
A: pKa is the pH at which half of the acid is dissociated. Given to us is the amino acid histidine with…
Q: Describe what you know about enzymes. Toxic hydrogen peroxide
A: Note: Hi! Thank you for the question. We are authorized to answer one question at a time. Since you…
Q: Mention all the enzymes and reagents used in the everse Transcriptase Polymerase Chain Reaction…
A: RT PCR is Reverse transcription polymerase chain reaction. This a process used to generally…
Q: CAN YOU PLEASE ANSWER 1b 1a) The phosphate groups in the sugar-phosphate backbone of each strand of…
A: DNA (deoxyribonucleic acid) is the nucleic acid that acts as the genetic material. Each strand of a…
Q: Predict the amino acid sequence based on the conditions below. Use the one-letter abbreviation of…
A: Amino acids are building block of polypeptide chain. its alpha carbon contains carboxyl group, amine…
Q: One single polypeptide chain (120 amino acid residues) is produced for protein A in prokaryotic…
A: A polypeptide chain is a linear or cyclic compounds which have amino acids as the building units of…
Q: 48. Which of the following is a definition of messenger RNA (mRNA)? a. RNA found in the ribosome,…
A: RNA stands for Ribonucleic Acid. It is the product of transcription. There are various RNA namely,…
Q: An athlete becomes dehydrated while running a marathon on a summer day. Which of the following…
A: Dehydration occurs when water is lost faster than it can be absorbed by the body. Water can be lost…
Q: a. The importance of recombinant DNA technology in Environment b. Potential products…
A: DNA : Deoxyribo nucleic acid. It is a polymer which is composed of two polynucleotide chains that…
Q: A) Write out both strands of the recognition sequences for BamHI and Sau3A, show what they would…
A:
Q: Suppose that the gene for a protein 500 amino acids in length undergoes a mutation. If the mutation…
A: Proteins are composed of amino acids. They are linked together by peptide linkages. Proteins have…
Q: Describe the process of denaturation of protein.
A: A native protein conformation is only marginally stable. So most proteins must maintain…
Q: The total concentration of enzyme in a reaction, [E], is made up of the concentration of enzyme…
A: Enzymes are the protein molecules that consist of active sites at which substrate molecules bind to…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- What would you predict about the ratio of hydrophilic to hydro- phobic amino acid residues in a series of monomeric globular proteins that range in size from a molecular weight of 10,000 g/mole to a molecular weight of 100,000 g/mole? Note that the volume of a sphere is 4/3nr³, while the sur- face area of the outside of a sphere is 4nr². How would your prediction change if the monomeric proteins were fibrous instead of globular?Bacteriorhodospin (Mw = 26 kDa) is a protein with purple colour. The protein acts as a light-activated proton pump that provides energy for cellular functions. The structure, revealed by both electron microscopy and X-ray crystallography, showed that the protein consists of 7 transmembrane spanning helices (TMH). Each TMH traverses the lipid bilayer completely (thickness of 45 Å). a)Calculate the minimum number of amino acid residues needed per TMH to completely cross the membrane. b)Estimate how large a fraction of the bacteriorhodopsin protein that is made up by TMHs. c)Now that you know the fraction of the protein that is made up by TMHs, at which ψ/φangles will the amino acids cluster in a Ramachandran plot?Consider a protein in which a negatively charged glutamic acid side chain (pKa = 4.2) makes a salt bridge (ion-ion interaction) with a positively charged histidine side chain (pKa = 6.5). Part A Do you predict that this salt bridge will become stronger, become weaker, or be unaffected as pH increases from pH = 7.2 to pH = 7.8? The salt bridge will become stronger. The salt bridge will become weaker. The salt bridge will be unaffected. Submit Part B Previous Answers Correct At pH = 7.2 the glutamic acid (Glu) side chain will carry a charge of ~ -1 (at 3 pH units above the pKa for Glu, the side chain will be almost fully ionized); whereas the histidine (His) side chain will carry a charge of < +0.5 (at pH = pK₂ the charge on His would be +0.5; since pH = 7.2 is above its pKa, it will carry less (+) charge as it becomes more deprotonated). As the pH increase to 7.8, the charge on Glu will remain ~ -1 and the charge on His will decrease; thus, this salt bridge is predicted to become weaker…
- Consider an amino acid (A) with no ionizable side chains, and call the three species involved in the acid/base equilibria H2A+, HA, and A- (see scheme below). Assume that pKa(1) = 2.0 and that pKa(2) = 9.0. Suppose that the total concentration of the amino acid is 1.0 mM. Report to two significant digits. pH [H2A+] (mM) [HA] (mM) [A-] (mM) 1.0 2.0 3.0 4.0 5.0 6.0 7.0 8.0 9.0 10.0 11.0 12.0In the molecule of oligomeric protein there are 19 lysine residues. 12 of them may be easily acetylated with anhydrides of dicarbon acids (it react with NH2-groups). The acetylation of extra two residues of lysine will dissociate the protein to the subunits. The rest 5 lysine residues may be modified only after denaturation of the protein. Suggest, how many lysine residues are: a) on a surface of protein globule; b) inside globule: c) in a site which is responsible for the contact within subunitsHair is comprised largely of keratin, a fibrous protein consisting of two a-helices wrapped around each other in a left-handed coiled-coil. The diagram below compares a partial alignment of the amino acid sequences of a form of human keratin and of ovine keratin. For each pair of dissimilar aligned amino acids, (i) indicate if a side chain is associated with a discrete charge by writing or (at pH 7) adjacent to the letter; and (ii) indicate whether each amino acid is polar (p) or apolar (a) in the case of aligned, electrostatically-neutral, side chains. In the diagram, 219 and 158 designate se-quence positions of the first aligned residue in each polypeptide strand. human II 5 219 ovine II 7c 158 FEQYINNLRRQLDSIVGERGRLDSELRNMQDLVEDFKNKYEDEINKRTTAE FEGYIETLRREAECVEADSGRLSSELNHVQEVLEGYKKKYEQEVALRATAE
- Consider a protein in which a negatively charged glutamic acid side chain (pKa = 4.2) makes a salt bridge (ion–ion interaction) with a positively charged histidine side chain (pKa = 6.5). (a) Do you predict that this salt bridge will become stronger, become weaker, or be unaffected as pH increases from pH = 7.0 to pH = 7.5? (b) Justify your answer with calculations of partial charges on these amino acid side chains.Consider a protein in which a negatively charged glutamic acid side chain(pKa = 4.2) makes a salt bridge (ion–ion interaction) with a positively charged histidine side chain (pKa = 6.5).(a) Do you predict that this salt bridge will become stronger, become weaker, or be unaffected as pH increases from pH = 7.0 to pH = 7.5?(b) Justify your answer with calculations of partial charges on these aminoacid side chains.At physiological pH (i.e. 7.4), polylysine assumes a random structure in solution. Given that the pKa for the e-amino group of lysine is 10.5, under what conditions would you expect polylysine to form an a-helix? Explain your reasoning. Under what conditions would you expect polyglutamate to form an a-helix, given that the pKa for the side-chain COOH group is 4.3?
- Which intermolecular forces are important in acetic acid, CH3 –(C=0)-oh? A particular amino acid contains a- CHNH3+ group. Is this amino acid more likely to be found on the inside or the outside of the folded protein? Briefly explain. The addition of ethanol, CH3CHOH, t an aqueous solution lowers the surface tension of the solution. Predict whether adding ethanol to an aqueous protein solution will tend to stabilize or unfold the protein. Briefly explain.Peptides and small proteins fold spontaneously in aqueous solution at room temperature. Thus, for a small protein in water, we can say ΔG FOLD < 0. Denoting the unfolded protein as Unf and the folded protein as Fld, we can write the following equation:Unf(aq)--DELTA G FOLD----> Fld(aq)Considering the transition from the unfolded state (in which there are many possible conformations) to the folded state (only one conformation), there is clearly a decrease in the entropy of the protein. However, protein folding is (correctly) described as an entropically driven process.a) Resolve this apparent paradox by identifying the enthalpy (ΔH) and entropy (−TΔS)components involved in protein…After staining an SDS-PAGE gel with Coomassie Blue G-250, the protein bands are visualized by de-staining the gel in a Coomassie Blue G-250 de-staining solution. This solution is made up of 10% acetic acid, 50% methanol, and 40% distilled water. How much of each of these components do you need to prepare 5 liters of Coomassie Blue G-250 de-staining solution?