Say you had the following DNA sequence: ATGCTGCGAAACTTTGGCTGA Let's say there was a mutation that removed one letter (the first C): ATGCTGCGAAACTTTGGCTGA Provide the 6 DNA codons that would be read following the mutation. Are they the same as the original 6 DNA codons that would have been read? Edit View Inscrt Format Tools Table
Q: A hypothetical base sequence of an RNA molecule is5′–AUUUGCCCUAGCAAACGUAGCAAACG–3′Make a drawing.
A: RNA stands for ribonucleic acid. It is a complex compound comprising of high molecular weight and…
Q: Translate the following RNA sequence by using the genetic below. Start at the beginning of the…
A: Protein is made up of a chain of monomeric subunits called amino acids joined together by peptide…
Q: Complete the following chart. Region Length Multiples of 3?
A: RNA is abbreviated as ribonucleic acid and it is composed of a ribose sugar, which is attached with…
Q: What kind of mutation is present in the following DNA strand?: Wild-type: 3'-AGTCCCTGAAAT-5'…
A: Introduction : Mutation is defined as a change in the DNA sequence. Mutation is an alteration that…
Q: Refer to Figure 9.7, then translate the following mRNA nucleotide sequence into an amino acid…
A: Ribonucleic acid (RNA) also contains genetic material but rarely takes part…
Q: Below is the 5’–3’ strand of a double-stranded DNA molecule with the following nucleotide sequences:
A: This question is based on the functioning of mRNA expression.
Q: Below is a sequence of DNA.…
A: The process of identifying the coding region and the position of a gene in a genome is known as gene…
Q: 5' GTGCTAGCGGGAATGAGCTGGGATACTAGTAGGGCT 3 33' САCGATCGCCCTTACТCGАСССТАТGATCАТССCGA 5' Template…
A: The DNA or deoxyribonucleic acid is the genetic material in living organisms. DNA contain genes that…
Q: Below is a segment of RNA, transcribed from a DNA sequence. Provide an example of each kind of…
A: Any detectable, inheritable qualitative or quantitative change in genetic material of an organism…
Q: Assume a bacterial gene underwent a mutation, where a thymine base from an early portion of the…
A: Protein consists of amino acids.
Q: The following are DNA fragments containing a small gene. The top strand is the coding strand.…
A: The genetic information of all living organisms (except some viruses) is stored in the cell in the…
Q: DNA 5' ATGGCTTCTCAATACTGCTTTGTTTTGGTT 3' template strand 3' TACCGAAGAGTTATGACGAAACAAAACCAA 5' coding…
A: The mRNA is produced by the process of transcription. And protein is produced by the process of…
Q: Imagine if there were 200 commonly occurring amino acids instead of 20. Given what you know about…
A: Introduction: 20 amino acids make up all the proteins. These are the building blocks of proteins…
Q: Now you will translate the amino acid sequence for the given tRNA strand. Remember that codons are 3…
A: According to Bartleby guidelines, we are supposed to answer first three subparts in case of…
Q: If you have got the following DNA template molecules, which one of them will require more energy to…
A: The DNA is composed of purines and pyrimidines. The purines in DNA are adenine and guanine. The…
Q: BamHI Haelll Both 10 kb 9 kb 8 kb 5 kb 2 kb 1 kb Figure 2 How long is the original DNA molecule?
A: If it is a closed circular DNA, BamH1 cut it into three fragments of length 10kb 5kb 2kb
Q: Which one of the following options would be a good way to identify the location of the poly A tail…
A: Pre mRNA undergoes several post-transcriptional modifications. One of these modifications is…
Q: Consider the following wild-type double-stranded DNA sequence: 5' TATGAA AGT3 non-transcribed strand…
A: A gene mutation that results from the substitution of one base pair of another. TATGAAAGT non…
Q: The following DNA sequence is part of one exon and contains the beginning of a gene’s open reading…
A:
Q: Second letter UUU Phenyl- UUC alarine UGU UGC Cysteine UAU UCU UCC UCA UCG UAC yrosine Serine UUA…
A: Mutation of amino acids change the primary structure of the protein which affects the protein…
Q: If you have got the following DNA template molecules, which one of them will require more energy to…
A: Melting temperature is the temperature at which a double-stranded molecule of DNA is broken down…
Q: A. The insertion shifts the reading frame to the right. The deletion frame shifts the reading frame…
A: 1) DNA Sequence: THE BOY CUT HIS LIP AND ARE THE HOT DOG Insertion: THE BOY CCU THI SLI PAN DAR ETH…
Q: Below is a short segment of DNA molecule. transcribed the DNA codon into mRNA.…
A: Convertion of TACCATGAGAATTGTGGTCACCTTTTT ATGGTACTCTTAACACCAGTGGAAAAA to mRNA is done and results…
Q: DNA: 3’ TACAGTCTGTAGCGTACATTATCGTGACCGACT 5’ Add an A before codon 3 or delete the middle base in…
A: A frameshift mutation occurs in the DNA sequence due to either addition or deletion of DNA bases…
Q: Here is our DNA sequence: T-A-C-A-T-G-T-T-T-A-G-G-T-C-C-A-C-C-C-G-T-G-G-G-A-C-T Write the RNA…
A: Introduction The process by which the genome's DNA is copied in cells is known as DNA replication.…
Q: Complete the table below: DNA DNA Complimentary Strand mRNA sequence tRNA sequence Amino…
A: Deoxyribonucleic acid is a molecule composed of two polynucleotide chains that coil around each…
Q: A Section of a Gene CTA AAA TAG TCT For the DNA sense strand sequence shown above, identify the…
A: DNA and RNA are nucleic acids present in the organisms. DNA is the deoxy ribose nucleic acid whereas…
Q: Below is a small stretch of DNA in the middle of a gene. What amino acid sequence would be encoded…
A: Amino acids are the organic compounds that contain amino group and carboxyl group functional groups…
Q: Given Sequence: 3’ – TACGGACTGATAGGCCCGCGCATC-5’ PLEASE PROVIDE THE RANSLATION OF THE FOLLOWING:…
A: The template strand is from 3` 5` and a coding strand of DNA is from 5` to 3`. The synthesis of m…
Q: Use the codon wheel on page 10.11 to identify any stop codons in the stop codons. Use the codon…
A: During transcription process RNA is formed with the help of complementary base pairing with template…
Q: CGG CCA UGU AUA UAA Enter your answer as a string without dashes, using three-letter abbreviations…
A: DNA ( Deoxyribonucleic acid) is a ladder like helical structure which serves as genetic material in…
Q: Transcribe the following DNA strand into mRNA and translate that strand into a polypeptide chain,…
A: Transcription is the process by which RNA is synthesized from DNA. The genetic material is…
Q: The sequence of a polypeptide is determined by the order of codons that specify the amino acids in…
A: Proteins are the ultimate products of the genes. DNA is transcribed into m RNA and this is…
Q: 3. DNA: TACGGGCCTATACGCTACTACT CA TG GATCGG MRNA: UC Codon: Anitcodon: Amino Acids: 4. DNA: G T…
A: Since we are entitled to answer first question, we’ll answer the question 3 as you have not…
Q: DNA gene TAC AGC TTT mRNA codon (No thymine in RNA!) tRNA anticodon (No thymine in…
A: According to Bartleby guidelines, the first three questions have been answered. Kindly post the…
Q: Which of the following mRNA codons could be changed to a stop codon by a single base pair…
A: A codon consists of three-nucleotides (A, G, C, or U) of RNA and carries the genetic information.…
Q: Using a codon table, complete the DNA triplets, mRNA codons, tRNA anticodons, and amino acids in the…
A: Genetic code is in triplets and the codes are read by the anticodon and thus the amino acids are…
Q: A. The insertion shifts the reading frame to the right. The deletion frame shifts the reading frame…
A: DNA is two stranded helical structure which act as template for making of mRNA. It also functions as…
Q: * Part of a sequence of DNA from a person without this genetic disease is: TAG TAA AAA CCA CCC AGG…
A: Anticodons are nucleotide sequences that are the opposite of codons. They're located in tRNAs, and…
Q: If DNA segments changes from GCATAG to GCATGG, this is a: MRNA Codon/Amino Acid Chart First Base…
A: The DNA sequence GCATAG will have the mRNA code CGUAUC. When the sequence changed to GCATGG, then…
Q: In the following table, below each DNA nucleotide, type in the complementary mRNA nucleotides. Then,…
A: Introduction : The genetic code is the set of rules by which information encoded within genetic…
Q: Using the codon charts in your text (section 6.1), fill in the chart below. [ /8] Original DNA…
A: The gene expression in the cells is brought about by the various processes of Replication…
Q: Why are 3 nucleotides needed for a codon? Because one nucleotide is redundant Because…
A: There are five nitrogen bases - adenine (A), guanine (G), cytosine (C), thymine (T) and uracil (U).…
Q: Codons The genetic code consists of triplets of nucleotides called codons. Refer to the genetic…
A: Cells are the building blocks of life. They are the constituent structural and functional units of…
Q: Which of these single strand RNA sequences could form a hairpin secondary structure? 5'…
A: The RNA is usually a single stranded molecule of nucleic acid. In RNA four types of nitrogenous…
Q: Use your codon chart to determine the amino acid sequence. Remember to read through the strand and…
A: Transcription is the process of copying information present in the DNA to RNA. The information…
Q: Using the example above, transcribe the following DNA strand into mRNA and translate that strand…
A: During transcription, the enzyme RNA polymerase uses DNA as a template to produce a pre-mRNA…
Q: What is the complementary DNA sequence to the following DNA sequence? ATGCCATCG…
A: DNA is genetic material which is involved in transfer of information into the protein. It involves…
Q: If you have got the following DNA template molecules, which one of them will require more energy to…
A: DNA is made out of four unique sorts of nucleotides, in particular, adenine, thymine, cytosine, and…
Q: The following are DNA fragments containing a small gene. The top strand is the coding strand.…
A: The process by which DNA is copied to RNA is called transcription, and that by which RNA is used to…
Trending now
This is a popular solution!
Step by step
Solved in 3 steps
- The following are DNA fragments containing a small gene. The top strand is the coding strand. Transcribe all groups and translate. FIND THE POSSIBLE MUTATIONS Group D 5’-GGCAATGGGTTTGTGCAATTCTAACAGTTTTTAATTC-3’ 3’-CCGTTACCCAAACACGTTAAGATTGTCAAAAATTAAG-5’ Group E 5’-GGCAATGGGTTTTGCAATTCTAAAAGTTTTTAATTC-3’ 3’-CCGTTACCCAAAACGTTAAGATTTTCAAAAATTAAGReplicate the DNA strand AAGGCTAACGGCATTTAACCC. Transcribe the DNA strand AAGGCTAACGGCATTTAACCC. Translate your answer to #16 using the table below. Second letter A G UGU cys UGC UUU PheUCU UCC UCA UCG UAU1 UUC UUA UAC J Tyr Ser UAA Stop UGA Stop A UAG Stop UGG Trp G UUGLEU CAUTHIS CÁC CUU CUC CUA CUG CCU] CCC CCA CCG CGU] CGC Arg Leu Pro CAA GIn CGA CGG. CAGS ACU ACC ACA AAC FAsn AAA AGU Ser AGC AGA LArg Lys AGGJ AUU AAU AUC le A AUA The AUG Mer ACG AAGJ GAU ASP GACJ GUU GCU GCC GCA GCG GGU GGC Gly GUC Val GUA Ala GAAG Glu GAGJ GGA GUG GGG Third letter DUAG JCAG DUAG C. First letterOh G A Stocking Stuffers | Artifact Uprising This is the sequence of a piece of DNA. TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT 1st letter Write the amino acid sequence of the protein that would be formed by translating this piece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids. Use the abbreviation of the amino acid exactly as it is written in the table (including the appropriate capitalizations) For example, if your answer for amino acid 1 is "Methionine" you would write MET in the box (not Met or met) U UUC Phe UCU UCC UUA | UUG U AUU A AUC AUA AUG GUU G GUC GUA GUG Leu CUU CCU C CUC Leu CCC Pro CUA CUG 1st amino acid: UCA UCG lle CCA CCG ACU ACC ACA Met ACG GCU Val GCC GCA GCG Sequence of the protein: C Second Letter A Ser Thr Ala UAU UAC Tyr UAA Stop learn.maricopa.edu CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG 1 UAG Stop UGG Trp G His Gin Lys Asp Asn AGU AGC AGA AGG Glu CGU CGC UGU UGC UGA Stop A CGA CGG G |…
- The following are DNA fragments containing a small gene. The top strand is the coding strand. Transcribe all 5 groups and translate. Group A 5’-GGCAATGGGTTTGTGCAATTCTAAAAGTTTTTAATTC-3’ 3’-CCGTTACCCAAACACGTTAAGATTTTCAAAAATTAAG-5’ Group B 5’-GGCAATGGGTTTGTGAAATTCTAAAAGTTTTTAATTC-3’ 3’-CCGTTACCCAAACACTTTAAGATTTTCAAAAATTAAG-5’ Group C 5’-GGCAATGGGTTTGTGCAATTCTAAGAGTTTTTAATTC-3’ 3’-CCGTTACCCAAACACGTTAAGATTCTCAAAAATTAAG-5’ Group D 5’-GGCAATGGGTTTGTGCAATTCTAACAGTTTTTAATTC-3’ 3’-CCGTTACCCAAACACGTTAAGATTGTCAAAAATTAAG-5’ Group E 5’-GGCAATGGGTTTTGCAATTCTAAAAGTTTTTAATTC-3’ 3’-CCGTTACCCAAAACGTTAAGATTTTCAAAAATTAAGFormat Tools Add-ons Help Last edit was seconds ago Arial BIUA Normal text 11 1 3 Which of the following molecules|are involved in gene expression? Choose all that apply. O RNA polymerase O Splicing O Primer O Origin O Stop codon O Start codon O Parental strand O IRNA O Okazaki fragment O Bubble OFork O Leading strand O Helicase O DNA polymerase OA site O Amino acid attachment site O Primase O Primer O Terminator sequence MAY 18 étv A MacBook Air6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…
- me Insert Design at Painter 278 words Calibri Layout 11.5A A Aa BIU-abe X₂ X² A--A- ype here to search Font W Unique Unigriffin DNA: mRNA: amino acids: traits: DNA: mRNA: amino acids: traits: DNA: mRNA: amino acids: traits: References # M 3 How DNA Determines Traits- Transcription and Translation Fill in easier type.pptx part 2 - Word Tell me what you want to do... Mailings Review View A-6-5- LLI Paragraph | CAG TCG TTT | ATG GGG CTT CTT TIT | GAG AAT TCA CGC I S4 | CGA CAA CAC | GTA GTA | CAA AAA ATG | TTA TAG AAT GAC GGG TGG | wwwwww O 2 A W R =-- | TTA TTG TTA CGG | AAA AGA CCT | GCA GCC TTG TGT | de in ACROBAT % 5 ¶ T 1 Normal AaBbCcDc AaBbCcl AaBbCcL AaBbCcDc AaBbCcDc AaBbCc[ AaBbCcD Aal 1 Body Text 1 List Para... 1 No Spac... 1 Table Par... Heading 1 1 Heading 2 Hea Styles Y 7 OM O 38°F JACQUI 10 LOriginal DNA DNA Protein TACGCTATGAGC Methionine-Arginine-Tyrosine-Serine Mutation #1 DNA What type of mutation occurred? substitution insertion duplication deletion TACTCTATGAGCK Ć Chrome File Edit View History Bookmarks. Profiles Tab Window Help Content X Biol 1406 X Content X Begin: Test X A Tutorial for X acconline.austincc.edu/ultra/courses/_891351_1/cl/outline A Unit 3 Ove X A Unit 3 Ove X ☎ D)) 33% Content Choose all the types of mutations which may result in a frameshift mutation: nucleotide insertion nucleotide substitution nucleotide deletion X G We G Trar Q
- Table I CACGT A GA CTGAGG ACTC CACGTAGACTGAG G ACAC Wild-type beta-globin gene fragment Sickle-cell beta-globin gene fragment > Circle the mutation in DNA of the sickle-cell beta-globin gene fragment Compare fragments of DNA the wild-type and mutant beta-globin genes in the Table I above, what are the similarities and differences you observe?6. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…Numbering the fragments left by cutting the DNA with BAM HI from left to right, which fragment will travel the furthest? BAM HI: GGATCC CCTAGG AATCGGATCCATTTGGACTAAAGGACCCGGATTGGATCCAGGGCCTTTAGTACC TTAGCCTAGGTAAACCTGATTTCCTGGGCCTAACCTAGGTCCCGGAAATCATGG O 3 O 2 4. 1.