Put these three molecules in the order of most oxidized to least oxidized. нн нс-с-н нн H > > 0= H-C-c H нн нефон H-C-C-ОН OH
Q: You will now build a 15 amino acid peptide using another paper or wire backbone as you did above.…
A: Peptides are polymers of amino acids. Proteins are primarily peptides. There are 20 general…
Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…
A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…
Q: Briefly explain partition coefficients. How is this concept applied in biotechnology?
A: The partition coefficient is defined as the concentration of the solute in the hydrophobic phase…
Q: Calculate the molecular mass of palmitic (hexadecanoic) acid (a fatty acid with formula C₁6H32O2).…
A: Molecular mass is the compound which consists of different atoms.It is calculated by taking the mass…
Q: Which of the following lists the stages of the Calvin cycle in order, starting with the stage where…
A: In the Calvin cycle, carbon atoms from CO2 are incorporated into organic molecules and used to build…
Q: Select the choice that best describes the stereochemistry of the following amino acid, and rank the…
A: Cysteine is one of the 20 standard amino acids that serve as the building blocks of proteins. It is…
Q: Molly is a 10-year-old girl of short stature with hyperelastic skin which bruises easily, and…
A: 1. Amount of Vitamin C in Jane’s diet fails to improve Jane’s symptoms because the dermatosparaxis…
Q: Which of these amino acids is a polar, uncharged amino acid? (Select all that apply, if necessary.)…
A: Amino acids are defined as the organic compounds that have amino (-NH3) and carboxylate (-COO- )…
Q: Refer to the figure below, what are the following forces of attraction is involved in the protein…
A: The tertiary structure of the protein is a 3D structure established and stabilised by the…
Q: The hydrolysis of phosphate bonds provides the chemical energy to drive reactions in the cell. The…
A: Gibbs free energy of hydrolysis of creatine phosphate to creatine isΔG°= -43kJ/molThis implies, its…
Q: II. Give biomolecules found in the animal body, characterize its type, a) organic or inorganic; b)…
A: Biomolecules are organic compounds that are found in living things and are crucial to their…
Q: Explain the chemical structure of ATP. Why is it considered to be a modified nucleotide?
A: Adenosine triphosphate (ATP) is an important molecule and is the source of energy for use, storage…
Q: The peptide KNYPEH N-terminal amino group has a pKa of 8.6 and the C-terminal carboxylate group has…
A: At pH 1, both the N-terminal amino group and the C-terminal carboxylate group will be protonated.The…
Q: PROTEINS 1. What will happen to free tyrosine after being subjected to xanthoproteic analysis (is it…
A: Proteins are large, complex biomolecules composed of multiple peptide-bonded amino acids. Proteins…
Q: Indicate what will happen ( increase, decrease or no effect) a. release of glucagon in the blood to…
A: Hormones can be described as chemical messengers. Hormones are synthesized by glands and…
Q: Why is the net charge 0 for cooh? Shouldn't it be +1?
A: Amino acids are biomolecules that have an amino group, a carboxyl group and a side group that is…
Q: Draw a diagram of the tetrapeptide Asn-Trp-Met-Ala (show all side chains and draw all peptide bonds…
A: Amino acids are the building blocks of proteins. A peptide bond is formed between the carboxy…
Q: Classify the fold of each domain as all a (or mostly a), all b (or mostly b), a/b, or a+b.. 1.…
A: 1.Firmicute collagen-binding protein (1FCB):Fold: All beta (mostly b)Domain classification: all…
Q: How does the puzzle look when completed?
A: Any change in the nucleotide sequence of DNA is called mutation. Mutations may be introduced…
Q: Find the charge of the peptide KEALYR at pH 7.2. Below is the pKa chart. Provide your answer up to…
A: Before going into the intricate and precise calculation that gives us the charge of the given…
Q: 7. A protein has a molecular mass of 400 kDa when measured by gel filtration. When subjected to gel…
A: As we know that the sodium dodecyl (SDS) sulfate is considered as the denaturing agent, which helps…
Q: Sickle cell anemia patients suffer from a distorted red blood cell shape and an anemic condition as…
A: d. In sickle cell anemia patients, 100% of the hemoglobin assembled contains the mutant β globin,…
Q: The equilibrium constant of a system, K, can be related to the standard free energy change, AG,…
A: Details
Q: It is necessary to purify the enzyme before the characterization process?
A: Amazing biological molecules called enzymes catalyze biochemical reactions in living organisms.…
Q: Identify weak noncovalent interactions of biomolecules in aqueous systems including hydrogen…
A: Understanding the complex weak noncovalent interactions of biomolecules in aqueous systems is…
Q: Find the connection among the words below and choose the letter of th word which is different. O A.…
A: DNA fragment separation is accomplished using the agarose gel electrophoresis technique. It…
Q: An intermediate folding stage seen in protein denaturation or renaturation is called : a) domain b)…
A: An intermediate folding stage seen in protein denaturation or renaturation is called :and option :a)…
Q: If the half-life for the decomposition of a drug is 4 hours, how long will it take for 225 mg of the…
A: In order to solve this problem, first we need to calculate the decay constant (). The half life…
Q: Determine whether each of the examples or phrases describes an essential amino acid, a nonessential…
A: Amino acids are the building blocks of proteins, which are essential molecules in living organisms.…
Q: Draw the haworth projection of starch (only 2 connected monomers) and cellulose (only 2 connected…
A: Chemically carbohydrates are polyhydroxy aldehydes or ketones. They have the general formula:…
Q: Which of the following classes of biological molecules do we commonly use for energy storage?…
A: Energy storage molecules are substances or molecules found in living things that originate with the…
Q: In an ammonia molecule, one nitrogen atom (atomic number = 7; 1s² 2s²2p³) forms covalent bonds with…
A: Ammonia (NH3) is a colourless gas with a strong odour that is made up of one nitrogen atom coupled…
Q: QUESTION 32 Which pair has similar chemical properties? O ¹H and 22 Na O 12C and 28gi O160 and 32
A: Atoms are the building blocks of matter, and the behavior of atoms in chemical reactions is…
Q: Draw the Ala-Ser-Leu-Asp polypeptide (perspective formula) showing the fully extended backbone…
A: Proteins are folded peptides. Peptides are polymers made up of amino acid residues linked via a…
Q: Each peak on the tandem mass spectrogram represents a product ion with a +1 charge. Use the…
A: Mass spectrometry is an analytical gel-free proteomics method used for identification of proteins,…
Q: Which uncharged amino acids (at pH 7) have the tendency to become positively charged? O Asparagine…
A: Amino acids can exist in a variety of ionization states at different pH. The environment's pH can…
Q: For a particular reaction, AH = -16.1 kJ/mol and AS° = −21.8 J/(mol·K). Assuming these values change…
A: To determine the temperature at which the reaction changes from nonspontaneous to spontaneous in the…
Q: Creatinine, C4H7N3O, is a by-product of muscle metabolism, and creatinine levels in the body are…
A: Let's calculate the mass of creatinine in a 10.0 mL blood sample. The normal level of creatinine in…
Q: Which of these amino acids is a hydrophobic amino acid? (Select all that apply, if necessary.) A. B.…
A:
Q: Draw the structure of lysine,arginine, and Cysteine in the protonation state that would predominate…
A: There are four classes of biological macromolecules. They are proteins, nucleic acids, carbohydrates…
Q: Label the key components of a matrix-assisted laser desorption/ionization time-of-flight, or…
A: Matrix assisted laser desorption ionization-time of flight mass spectrometry (MALD1-TOF) is a…
Q: Using the pka data for lysine, draw the molecular species present at each of the following pH values…
A: Lysine has 3 ionizable groups in it. They are;alpha- carboxyl groupalpha-amino groupside chain basic…
Q: Would the base pair Guanosine and Cytosine be more or less stable at pH 10
A: The stability of a base pair like Guanosine (G) and Cytosine (C) can be influenced by pH, but in the…
Q: This image shows the tertiary structure of a protein segment. Tertiary structure results from…
A: Ionic bond is formed between a positively charged and a negatively charged group. The charged groups…
Q: can you tell what the pKas are from this unknown amino acid based on buffering regions and narrow…
A: pH = If [H+] concentration in a solution is high, the pH will be low and the solution is acidic. If…
Q: Describe the structure and function of the bacterial cell wall, and explain it importance as a…
A: (1) Structure of bacterial cell wall - The bacterial cell wall is made up of peptidoglycan or…
Q: Please help! Sketch a titration curve of the peptide Ala-Tyr-Gln-Met-Asp-His from pH=0 to 14 up to 5…
A: Titration is used to determine the amount of acid in a solution.Sodium hydroxide or potassium…
Q: Given the data for Chymosin shown below: What are the catalytic constants (i.e. Km and Vmax) for…
A: Km is the catalytic constant which is equal to substrate concentration at half of maximal…
Q: 8. When oxygen binds to the heme group, by how many angstroms does the Fe2+ appear to shift? 9. How…
A: The heme group is a prosthetic group in oxygen-binding protein. Its primary function is to bind…
Q: Draw a diagram of a peptide bond in the cis and trans configurations. Show the contributing…
A: The amino group (NH2) of one amino acid and the carboxyl group (COOH) of another amino acid can join…
Trending now
This is a popular solution!
Step by step
Solved in 3 steps with 8 images
- Acid phosphatases are an important group of enzymes that can be detected in human blood serum. Under slightly acidic conditions (pH 5.0), this group of enzymes can hydrolyze biological phosphate esters as follows: R-O-P-O;² + H 20 → R-OH + HO-P-O;² Acid phosphatases are produced and can be detected in erythrocytes, kidney, spleen, the liver, and prostrate gland. The enzyme from the prostrate gland is clinically important because an increased activity in the blood is frequently an indication of cancer of the prostrate gland. Tartrate ion can strongly inhibit the phosphatase from the prostrate gland, but not acid phosphatases from other tissues. How can you use the information above to develop a specificThe following reaction is catalyzed by this type of enzyme? Coo COO™ I HIC-H H-C-H COO™ succinate isomerase hydrolase O ligase transferase oxidoreductase succinate dehydrogenase FAD FADH2 H-C || C-H COO fumarateEthylene glycol (HO—CH2—CH2—OH) is frequently used as antifreeze in automobile engines. Every year children and pets are poisoned because they tasted this sweet-tasting material. Ethylene glycol is metabolized in the liver by alcohol dehydrogenase. Suggest a possible medical treatment for ethylene glycol intoxication.
- The reaction pictured is an oxidation-reduction reaction in the citric acid cycle in which the energy-carrier molecule NADH is generated. Identify which molecule in the reaction will be oxidized and which molecule will be reduced. Place a single answer choice in each box. COO- HO-C-H H-C-H COO- Malate NAD+ NADH + H+ Oxidized malate oxaloacetate COO- H-C-H ī COO- Oxaloacetate Reduced NADH NAD+A critical reaction in the production of energy to do work or drive chemical reactions in biological systems is the hydrolysis of adenosine triphosphate, ATP, to adenosine diphosphate, ADP, as described by the reaction ATP(aq)+H2O(l)⟶ADP(aq)+HPO2−4(aq)ATP(aq)+H2O(l)⟶ADP(aq)+HPO42−(aq) for which Δ?∘rxn=−30.5 kJ/molΔGrxn∘=−30.5 kJ/mol at 37.0 °C and pH 7.0. Calculate the value of Δ?rxnΔGrxn in a biological cell in which [ATP]=5.0 mM,[ATP]=5.0 mM, [ADP]=0.10 mM,[ADP]=0.10 mM, and [HPO2−4]=5.0 mM.[HPO42−]=5.0 mM. Δ?rxn=ΔGrxn= kJ/molWhy is the Na/K is also called Na/K ATPase?
- The citric acid cycle contains four 4-carbon dicarboxylic acids. (a) Name them.(b) Arrange them in order from least oxidized to mostoxidized.In cellular respiration, glucose is oxidized to CO2 and oxygen is reduced to water. A) True B) FalseThe phosphorylation of glucose to glucose 1-phosphate requires 5.0 kcal/mol of energy. This unfavorable reaction can be driven by the hydrolysis of ATP to ADP. (a) Write the equation for the coupled reaction. (b) How much energy is released in the coupled reaction? glucose + HPO4---------->2– glucose 1-phosphate + H2O
- You digest the octapeptide Met-Glu-Arg- His-Met-Cys-Phe-Leu with trypsin, chymotrypsin and cyanogen bromide all in the same beaker. Which of the following correctly lists the isoelectric points for all of the fragments that are produced in your digest? Relevant pKa values are; 2.2, 4.3, 6.0, 8.3, 9.8 and 12.5. 5.3, 6.0, 6.0, 7.1, 7.9 3.3, 6.0, 6.0, 7.1, 7.9 5.3, 6.0, 6.0, 7.1, 7.9, 11.2 O 5.3, 6.0, 6.0, 7.1, 11.2 5.2, 5.3, 5.3, 7.1, 7.9Acid phosphatases are an important group of enzymes that can be detected in human bloodserum. Under slightly acidic conditions (pH 5.0), this group of enzymes can hydrolyzebiological phosphate esters as follows:R-O-P-O3-2 + H2O -----> R-OH + HO-P-O3-2Acid phosphatases are produced and can be detected in erythrocytes, kidney, spleen, the liver,and prostrate gland. The enzyme from the prostrate gland is clinically important because anincreased activity in the blood is frequently an indication of cancer of the prostrate gland.Tartrate ion can strongly inhibit the phosphatase from the prostrate gland, but not acidphosphatases from other tissues. How can you use the information above to develop a specific procedure for measuring the activity of the acid phosphatase of the prostrate gland in humanblood serum?20.12 Classify the enzyme that catalyzes each of the following reactions: |3| a. CH3-C-COO + CO2 + ATP OOC-CH2-C-COO + ADP + P; + H b. CH3-CH2-OH + NAD* CH3-C-H + NADH + H*