Q: ADH1A alcohol dehydrogenase 1A (class I) Describe a way in which the gene can be manipulated to…
A: * The gene ADH1A alcohol dehydrogenase gene encodes a member of the alcohol dehydrogenase family.…
Q: Explain the mechanism action of denaturation of protein from egg (Albumin) using extreme heat
A: Proteins have a structure that is bound by multiple bonds folded together in a specific pattern. The…
Q: A. Elastase is activated by trypsin B. Trypsinisactivatedbyelastase Which statement is correct?
A: Note- we are supposed to answer one question according to our guidelines. Please repost other…
Q: Cyanobacteria are photosynthetic prokaryotes that are likely responsible for generating the gen-rich…
A: Answer :: An alternative pathway for glucose oxidation is the pentose phosphate pathway (PPP). In…
Q: 1. Trypsin-mediated enzymatic disaggregation of tissues is known as-▬▬▬▬.
A: Enzymatic disaggregation help to process tissue samples when a high recovery of cells is necessary.
Q: cAMP has a short lived life as it is quickly metabolized by phosphodiestrase true false
A: Cyclic AMP or cAMP act as a second messenger for protein harmones and catecholamines.it mediates the…
Q: Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG…
A: The polymerase chain reaction is a molecular technique responsible for exponentially amplifying a…
Q: Which of the following protein domains would you expect to find in an "easily druggable" target b…
A: * protein domain is a part of protein sequence and tertiary structure that can function and evolve…
Q: What if the drug inhibited the linking of NAG directly to NAM in peptidoglycan? Would you expect it…
A: Antibiotics are medicines used to prevent and treat bacterial infections. Antibiotic resistance…
Q: Can you please elaborate why blocking the inhibitory G protein from deactivating adenylate cyclase…
A: The inhibitory G protein has a role in the body’s biochemistry, including in the peripheral regions…
Q: 11. Explain the role of cytochrome c, Bax/Bac, Fas receptor-ligand, caspases, IGFBP3 in causing…
A: Apoptosis is the process of programmed cell death. When excessive DNA damage occurs or proper…
Q: What peptides are expected to be produced when α-melanotropin is cleaved by (a) trypsin, (b)…
A: Protein is a polymer of amino acids connected together via a peptide bond. It may have one or…
Q: Please answer if it’s true or not and give explanation. Thank you ? 1-Is uridine…
A: Skatole is from the family Indole and Indole is an aromatic heterocyclic compound having a bicyclic…
Q: A 9 year old child was brought to the clinic with a history of failure to thrive. Further…
A: In the given question, child presents with failure to thrive, generalized hypotonia, hepatomegaly…
Q: Please answer if it’s true or not and give explanation. Thank you ? -Is uridine diphosphoglucuronic…
A: Skatole or 3-methyl indole and indole are produced from tryptophan through tryptophan metabolism.…
Q: Complete the analogy and choose the correct option Argentaffin cells : serotonin : : Paneth cells :…
A: Argentaffin cells are those that retain silver stain. Enteroendocrine cells are also known as…
Q: What is the relationship between Warburg effect and oncogenesis? Explain why cancer cells have…
A: Chemoresistance itself has been associated with increases in hexokinase (HK) behaviour due to the…
Q: Authophagy refers to naturally regulated mechanisms of degradation and removal of dysfunctional…
A: Denaturation is the phenomenon through which proteins or nucleic acids loses their native…
Q: CHOOSE THE CORRECT ANSWER. PLS ANSWER. 1.What could be the possible condition that will contribute…
A: Gluconeogenesis is a metabolic pathway that breaksdown certain non-carbohydrate substrates (animo…
Q: 15. What is the structural feature of the accumulated membrane lipids involve in the case number 13…
A: All plasma membranes, regardless of source, contain proteins as well as lipids. The ratio of protein…
Q: Does PFK-2 (Phosphofructokinase-2) have coenzymes and Allosteric reguation?
A: Enzymes are proteins that play a major role as biochemical catalysts in speeding up a biochemical…
Q: 16 whe Which statement is TRUE for the reciprocal regulation of phosphofructokinase-1 (PFK-1) and…
A: Introduction: The process by which the glucose (6C compound) is split into two molecules of pyruvic…
Q: Write some alternative names of HMG-CoA?
A: Cholesterol is the wax-like lipid that is synthesized by all animal cells. It is a sterol and is an…
Q: Using the experimental results, describe the pathway that secretary proteins take from their…
A: Proteins are synthesized through the interaction of mRNA and tRNA which interact with each other In…
Q: What is the purpose of using CNBr in this experiment?
A: The recombinant insulin can be produced by the inserting the genes for α and β polypeptides into a…
Q: Overall RNA metabolism and proteins involved are regulated by ubiquitin signaling. Explain how…
A: Post-translational modification refers to the covalent and generally enzymatic modification of…
Q: What are some effects of very high or abnormal ACTH? checkmark all that apply. Lowered rates of…
A: Our body physiological processes are under the control of hormonal activities. The hormones are the…
Q: Autophagy is an evolutionary conserved catabolic process devoted to the degradation of intracellular…
A: Introduction : Autophagy is the natural process of break down and destroying old , damaged cells…
Q: Would the TCA cycle happen faster or slower when the cell is also carrying out gluconeogenesis?
A: Introduction: The process of creating glucose from non-carbohydrate molecules is known as…
Q: a) What is the role of the lysosome in degrading proteins? What are the enzymes that…
A: Hi! Thank you for the questions. As you have posted multiple questions, I will be answering the…
Q: Hello, please answer the questions 1, 2, 3, 4, 5, 6, and 7 directly 1. What is isoelectric…
A: Hi, thank you for posting the question on Bartleby. As per the guidelines we can answer first three…
Q: what carbohydrate is not produced in the pentose phosphate pathway? glucose 6-phosphate…
A: Hexose monophosphate shunt or PPP pathway is a pathway which involves glucose oxidation. There are…
Q: Fully explain in the form of a detailed and annotated diagram how DnaK is involved in the heat shock…
A: Heat shock response is considered as the stress response of cell which leads to incline in the…
Q: - Multiple Choice - Explain your answer in 3-5 sentences. - answer properly QUESTION: Which of the…
A: ADP-ribosylation: The attachment of one or more ADP-ribose moieties to a protein is known as…
Q: Two molecules of ATP and 4 molecules of GTP are consumed to produce one molecule of glucose in…
A: Gluconeogenesis is a reverse pathway of glycolysis. In this pathway, glucose is synthesized from…
Q: Provide three examples of changes in glycolysis/TCA that lead to increased biosynthesis, and,…
A: Glycolysis and TCA are metabolic pathways through which cells oxidize fuel molecules (respiratory…
Q: If extracellular levels of carbohydrate are high, this molecule triggers the import of…
A: Those chemical carriers that help in sharing information between tissue to tissue or cell to cell…
Q: A common starvation or generalized stress signal produced and sometimes secreted by bacterial,…
A: Growth curves are generally the description of the density of cell populations in liquid culture…
Q: You can choose one or more than one options Arginase is an enzyme that : BIOCHEMISTRY advanced…
A: Most but not all enzymes are proteins. Enzymes are highly specific. All cellular…
Q: Transfer of sugars is usually achieved by activation of
A: Transfer of sugars is usually achieved by activation of UDP.
Q: Predominant nucleotides during protein synthesis are the GTPs.
A: Protein synthesis is the most important, essential, and significant metabolic activity of living…
Q: explain whether lactase enzyme is secreted as a zymogen requiring activation or not. If it is,…
A: The lactase enzyme is a beta-galactosidase that hydrolyses lactose to glucose and galactose. A…
Q: (AKS 8a, DOK 2) Students in biology classes at MHS have been conducting an experiment that invloves…
A: The major bioethical concerns to Biotechnology are Fear of transfer of allergens which further…
Q: 11. Explain the role of cytochrome c, Bax/Bac, Fas receptor-ligand, caspases, IGFBP3 in causing…
A: Apoptosis or the programmed cell death involves a series of biochemical changes, that ultimately…
Q: Hi, can you please explain the clinical significance of G protein mutations.
A: Introduction:- G proteins control transcription, motility, contractility, and secretion, which in…
Q: A hydrophilic drug A.Has a high reabsorption in renal tubules B.Has a low ability to penetraye the…
A: We'll answer the first question. Since the exact one wasn't specified. Please submit a new question…
Q: Can you explain the regulation of PFK-1 by ATP and AMP?
A: PFK-1 stands for Phosphofructokinase-1 is the essential regulatory enzyme of the glycolysis pathway.…
Please don't copy please answer expert biochemistry
Step by step
Solved in 2 steps
- Can I get help please with this question? Two mutations have occurred to proteins within the glucagon signaling pathway: A) The glucagon receptor has a mutation. This mutation causes this GPCR to always have a conformation that will induce nucleotide exchange for any associated heterotrimeric G proteins, even without glucagon binding to the receptor. B) The alpha subunit of the heterotrimeric G protein has a mutation. This mutation causes the Gαarginine finger to always be in a position to properly order the catalytic residues within the Gαsubunit to promote catalysis. Question: What will the combined effect of both mutations be on the signaling pathway and what is the mechanistic reason for this effect?1117 increase in the number of passive glucose transporter on the muscle cell surface thus increases the uptake of glucose into the cell and decreases blood glucose level. Indicate whether the following conditions/practice will likely lead to diabetes (mark Yes or No). [Select] a mutation in a V-SNARE in islet cells that blocks all secretion Q Search ******* 40 ****** 99+ app.honorlock.com is CDesign a pair of primers to amplify the human Insulin gene (only the blue region) Human Insulin CDNA (gene sequence, 5'-untranslated region, 3'-untranslated region) 5'agecete agccctccaggacaggctgcatcagaagaggccatcaagcagatcactgtccttctgccATGGCCCTGTGGA TGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGACCCAGCCGCAGCCTTTGTGAACCAAC АССТСTGCGGCTCАCАCСТGGTGGAAGCTCTCТАССТАGTGTGCGGGGAACGAGGCTTCTTCTACАCACСCА AGACCCGCCGGGAGGCAGAGGACCTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCC TGCAGCCCTTGGCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAACAATGCTGTACCAGCATCTGCT CCCTCTACCAGCTGGAGAACTACTGCAACTAGacgcagcccgcaggcagccccccacccgccgcctcctgca ccgagagagatggaataaagcccttgaaccaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaŋ' Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN* 5'-C 5'-I ]-3' ]-3' Primer: I Primer: 2 I know the answers are 5'-ATGGCC-3' for primer 1 and 5'-CTAGTT-3' for primer 2 but I'm not sure why. Could some explain why?
- In Alzheimer’s disease, nerve cell death is associated with the accumulation of aggregates of misfolded protein. Compare this process with the onset of diabetes mellitus.HbA1c is used to monitor blood glucose levels because hemoglobin is the only protein in blood that is covalently modified by glucose. True False Insulin Glargine is a long-acting form of insulin that is synthesized with several D-amino acids that slow its proteolytic degradation and extend the half-life of the insulin Glargine molecule. True False"Continual addition and removal of phosphates by protein kinase and protein phosphatases is wasteful of energy-since their combined action consumes ATP-but it is a necessary consequence of effective regulation by phosphorylation" is true or false.
- Please answer the following questions 1. Give the substrate for each of the following enzymes: a. dihydrofolate reductase b. acetylcholinesterase c. lactate dehydrogenase d. DNA polymerase e. aspartate transaminaseWhich one of the following statements concerning disorders of muscle metabolism presented in class is incorrect? a) Mutations in animals can spread rapidly because of line breeding to prolific males. b) The low rate of metabolism and ATP consumption in muscle and nerve makes effects of mitochondrial myopathies less observable in these tissues. c) Glycogen storage diseases resulting from mutations in glycolytic and glycogen pathway genes typically cause accumulation of abnormal glycogen and/or exercise intolerance. d) Lipid storage myopathies can result from deficiencies in enzymes of Beta-oxidation and lead to the accumulation of triglyceride droplets in muscle fibers. .Collagen is the main protein component of the ECM. The process of collagen synthesis is complex and it occurs intra- and extra-cellularly involving different organelles. Explain in details the collagen synthesis process. citation and references are requiard.
- In 2-3 paragraphs (must be typed) explain: Discuss the regulation of cholesterol synthesis.Now answer the following questions: 1. Is this patient experiencing a disorder affecting anaerobic or aerobic metabolism? a) disorder affecting anaerobic metabolism. b) disorder affecting aerobic metabolism. c) None of them d) Both 2. You decide to perform assays to check the activity of one or more metabolic enzymes in the red blood cells. Which enzyme(s) would you check? a) Amylase b) Enzymes of pentose phosphate pathways c) Transaminase enzymes d) hexokinase, phosphofructokinase, and pyruvate kinaseHow is Pyruvate Kinase Deficiency (PKD) inherited? What gene is responsible for the expression of the PK enzyme?