Glycogenesis occurs in both muscle and liver. Select one: O True O False Glycogen is released from the muscle due to increased CAMP due to: Select one: O a. Growth hormone O b. Epinephrine O c. Thyroxine O d. Glucagon UDP-Glucose is converted to UDP-glucoronic acid by: Select one: O a. NADP O b. ATP O c. GTP O d. FAD Oe. NAD In the fasted state gluconeogenesis is promote by which enzyme Select one: O a. Fructose 2,6 bisphosphate induced stimulation of phosphofructokinase-1 O b. Acteyl CoA induced stimulation of pyruvate carboxylase O c. Citrate induced stimulation of Acetyl CoA decarboxylase Glyconeogenesis prevents hypoglycemia during prolonged fasting. Select one: O True O False
Q: Below is the skeletal formula of a molecule typically found in cell membranes. What type of molecule…
A: The biological membrane that surrounds a living cell is called the cell membrane. The structure of…
Q: With respect to DNA and RNA polymerases which statement is correct? OA) Only DNA polymerases are DNA…
A: DNA and RNA polymerases are enzymes that work on DNA. DNA polymerase is responsible for DNA…
Q: (a) Estimate the Km and Vmax for the wild-type and mutant enzyme from the graph. (b) Calculate the…
A: For a one-substrate enzyme catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Chemicals such as cyanide and carbon monoxide can be deadly. This is because they directly inhibit:…
A: CO is a colorless, odorless gas that is formed by incomplete combustion of carbon compounds. CO…
Q: Zoey Wong is a research officer at the Department of Biosciences of Tunku Abdul Rahman University…
A: The basic principles of the central dogma of molecular biology is similar in both prokaryotic and…
Q: Hydrophobic interactions associated with protein tertiary structure involves: Acidic and basic…
A: During hydrophobic interaction, the non-polar molecules come together and interact with each other.…
Q: A PCR reaction was performed to amplify the XULA3 gene, which is bp 882-5,364 on a plasmid that is…
A: The Polymerase chain reaction is a laboratory technique that is used to make multiple copies of a…
Q: Why is cholesterol an important steroid?.
A: Cholesterol is a steroid. a steroid is a compound having a cyclopentanoperhydrophenanthrene (CPPP)…
Q: Sketch the graph for velocity v.s. substrate concentration for enzyme 1 and enzyme 2. They have…
A: Vmax is the maximal velocity that a reaction can reach when all the enzyme molecules are saturated…
Q: 3. Predict the effect of each of the following amino acid substitutions on the KM and keat of the…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Tumor necrosis factor (TNF) signaling Discuss the nature of the TNF ligand and the receptor for…
A: Cell signaling pathway involves a cascade of reactions inside the cell which is triggered by small…
Q: 20000 Indicate enzymes of glucose metabolism directly or indirectly impacted by the action of…
A: Glucose metabolism is comprised of several processes, including glycolysis, gluconeogenesis,…
Q: Answer in brief sentences in your own words please thank you! 1. Soon after the bolus reaches the…
A: Starch is a complex carbohydrate. Starch digestion starts in the mouth but occurs mostly in the…
Q: In beta-oxidation, which cofactor is required the for second oxidation reaction (conversion of…
A: Fatty acid β-oxidation is the metabolic process by which fatty acids are broken down to produce…
Q: calculate the [PNP] in μM for each of these samples.
A: Molarity is way of representing the concentration of a solution. Molarity is number of moles of…
Q: . What is the nucleotide sequence of the complementary strand of the DNA molecule:…
A: DNA is the genetic material in most organisms. During transcription RNA Polymerase synthesizes the…
Q: The PDH complex is a logical point of regulation in metabolism, as it links two major catabolic…
A: Cellular respiration is a collection of three metabolic pathways that generate ATP the energy…
Q: Which of the following statements concerning ATP synthesis is NOT true?
A: Oxidation of glucose in the glycolysis and TCA cycle generates electrons carriers NADH and FADH2, As…
Q: 8. Features of anaerobic oxidation of glucose in erythrocytes. Pyruvate kinase, its biological…
A: Anaerobic oxidation (or Glycolysis): Anaerobic glycolysis is the conversion of glucose to lactate…
Q: Enzymes are important molecules in biochemistry that catalyze reactions. The energy diagram…
A: Since there are multiple questions and which question is to be solved has not been specified, as per…
Q: agent). The type of binding that is disrupted by A) Peptide bonds B) Trans double bonds C) Cis…
A: The proteins are composed of twenty naturally occurring amino acids that are connected by peptide…
Q: MATHEMATICAL For the following aspartase reaction (see Ques- tion 28) in the presence of the…
A: Assuming the enzyme follows Michelis Menton's enzyme Kinetics. The initial velocity of the enzymatic…
Q: Which of the choices are types of posttranslational modifications a newly synth choices that apply.…
A: Posttranslational modifications are the amino acid side chain modification in some proteins…
Q: *The enzyme glucose oxidase isolated from the mold Penicillium notatum catalyzes the oxidation of…
A: Carbohydrates are polyhydroxy aldehydes or ketones. They can be classified as monosaccharides,…
Q: Label the diagram below as either passive transport (diffusion or facilitated diffusion) or active…
A: Biological membranes are structures that surround the cell or organelles and act as barriers. An…
Q: 7. WHAT IS A PHOSPHODIESTER BOND? WHERE CAN IT BE FOUND? 8. GIVE AT LEAST 10 CARBOXYLIC ACIDS THAT…
A: Biomolecules are composed of monomeric units that are joined together through specific bonds.…
Q: Explain why the combined presence of polyphenol oxidase and iron greatly increase the instability of…
A: Introduction Fatty acid is one of the macromolecule present in our body. Fats and oils are composed…
Q: Primer design worksheet T7 Promoter Kpn ...KS primer binding site Eco01091 Dra Il BasH II…
A: Polymerase chain reaction (PCR) is a molecular biology technique that can make multiple copies of a…
Q: in triacylglycerol mobilization, triacylglycerol molecules is activated by: phosphorylation…
A: Triacylglycerol are esters of fatty acid and glycerol. Triacylglycerol, as the name indicates,…
Q: Why is cholesterol an important steroid?
A: Steroids are the compounds that consist of three cyclohexane rings and a cyclo pentane ring in…
Q: The Standard free energy CAG0¹) of the reaction shown above can be estimated based on? A. High…
A: Standard free energy of a reaction (∆Go') is the amount of energy released or consumed in the…
Q: Label: 1) the type of chemical bonds between the amino acids (e.g. covalent bond, ionic bond,…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: 3. Compare and contrast how thiolase and chymotrypsin creates and stabilizes its intermediates.
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: 1. Draw the open-chain form for each of the following monosaccharides. CH OH HO OH HOCH₂ он HO 0. он…
A: Monosaccharides are represented in two forms-the cyclic form and the open form. The open form is…
Q: Which of the following describes the interaction between the amino acid last eluted and the anion…
A: In Ion exchange chromatography the molecules are separated according to their charge. The matrix…
Q: The steady-state kinetics of an enzyme are studied in the absence and presence of an inhibitor B…
A: Enzymes are protein molecules that increase the rate of reaction by decreasing the activation…
Q: Describe the changes that occur in each step of the mechanism.
A: Enzymes are high molecular weight proteins that catalyse biochemical reactions. Proteases are…
Q: Mechanistic probes often require the use of an electrophilic functional group to interact with an…
A: A nucleophile is a chemical species that is negatively charged or has a high electron density or a…
Q: In 1971, Dr. Akira Endo, working at the Sankyo company in Tokyo speculated that fungi not only…
A: Since you have posted a question with multiple sub parts, we will provide the solution only to the…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: There are eight chemical reactions that occur in the citric acid cycle process. The reactions of…
A: In cellular respiration, glucose is oxidized during glycolysis and the end product (pyruvate) is…
Q: 4. Deducing quaternary structure via SDS-PAGE. SDS-PAGE is a convenient method for separating…
A: SDS-PAGE is a chromatographic technique that is used to separate proteins based on their molecular…
Q: Which of the following would NOT be expected in congenital erythropoletic protoporphyria: A…
A: INTRODUCTION : Congenital erythropoietic protoporphyria - It is a disorder which effects the…
Q: Fatty acids and triglycerides are an important source of nutrition and a dense form of stored…
A: Carbohydrates are the primary source of energy. But in the absence of carbohydrates, the body…
Q: Why doesn't the net reaction for the citric acid cycle have intermediates (citrate, isocitrate,…
A: Citric acid cycle is an amphibolic pathway that completely oxidizes the acetyl CoA obtained through…
Q: Norelly. 16-27 How does chitin differ from cellulose in structure and func- tion? Biochemistry Name…
A: Chitin is a polysaccharide-based fibrous substance that is the primary component of the exoskeleton…
Q: Write the reaction equation for the formation of sucrose, indicate the bonds that connect the in the…
A: Monosaccharides are smallest or basic subunit of carbohydrates by which disaccharides,…
Q: [1,6-(C-14)-2,5-(C-13)]glucose Trace the course of through glycolysis and the TCA cycle. You need…
A: Carbon tracing is the method by which we trace the path taken by each carbon atom in a substrate, as…
Q: Suppose a liver extract capable of carrying out normal metabolic reactions (including…
A: The formation of glucose from pyruvate occurs through the process of gluconeogenesis which occurs in…
Q: 1. Draw the open-chain form for each of the following monosaccharides. CH OH HOOH НО CH₂OH OH OH он…
A: Monosaccharides Carbohydrates are polyhydroxy aldehydes or ketones. They can be classified as…
Step by step
Solved in 6 steps
- Based on your understanding of the binding of insulin, select all of the following events that you would expect to occur in muscle cells due to insulin binding to receptors.Group of answer choices a. Glycogen synthesis is activated b. PFK is stabilized in the R-state and glycolysis is activated c. GLUT4 (transporters) are increased in concentration at the plasma membrane d. Fructose 2,6-bisphosphate increased levels aid in stabilization of the T-state fructose 1,6-bisphosphatase e. Gluconeogenesis is activated in response to elevated fructose 2,6-bisphosphate levels f. Phosphorylation cascades allow for covalent modifications that would aid in the breakdown of glycogen to allow for increased levels of glucose 6-phosphate in the cell g. Hexokinase is inhibited so glucose will not be brought into the cell in high amounts h. Glycogen breakdown pathway is inactivatedWhich of the following activate glycogen synthesis? A. Phosphorylation of glycogen synthase kinase 3 B. Activation of protein kinase A (PKA) C. Both A and B D. Neither A nor B Assuming that glucokinase is completely inhibited, which of the following statements is correct? Glycolysis reactions beyond glucose-6-phosphate in the liver would be impossible to take place The Cori cycle would be blocked Both A and B Neither A nor BEpinephrine binding allows the "fight-or-flight" response. Think about how this would differ from insulin binding. In the muscle, what would you expect for pathways use of glucose 6-P? Select all that apply. a. Glycogen breakdown is activated to produce glucose 6 - phosphate b. Glucose 6-phosphatase is activated to allow glucose release from muscle cell c. Pyruvate kinase is stabilized in the T-state d. Glycogen synthesis is activated e. PRK is stabilized in the R-state, glycolysis is activated
- After eating a large meal, which one of the following events would NOT happen? A. Increased glycolysis in liver B. Increased glycogen phosphorylase activity O C. Decreased phosphorylase kinase activity O D. Decreased GSK-3 activity E. Increased insulin levels in bloodInsulin therapy has all of the following effects, except:A. Increases concentration of free fatty acids in blood plasma B. Stimulates glucose uptake by tissuesC. Inhibits lipolysisD. Activates protein synthesisIn muscle, glycogen phosphorylase is stimulated (activated) by a. Glucose b. AMP c. Glucose 6-phosphate d. ATP
- A 30 year old man who has type I diabetes mellitus with a blood glucose of 340 mg. One hour after eating he administered a dose of short acting insulin. After treatment what is most likely increased in the liver? a. cAMP b. G6P activity c. PFK 1 d. phosphorylation of pyruvate kinase e. PKACHOOSE THE CORRECT LETTER When glycogen is synthesized in both the liver and muscle, all the following are true, EXCEPT A.Glucose is transferred from UDP-glucose to a growing glycogen molecule by glycogen synthase.B. Phosphoglucomutase converts glucose 6-phosphate to glucose 1-phosphateC. Glucose 6-phosphate is converted to glucose by a phosphatase.D.Glucose 1-phosphate is activated by UDP-glucose pyrophosphorylase to produce UDP-glucose and PPi.which of the following are possible sources of glyceraldehyde 3-phosphate a. more than 1 correct response b. 2 moles of glucos c. cleavage of fructose-1-6-biphosphate d. dihydroxyacetone phosphate
- The synthesis and degradation of glycogen in muscle is not a futile (ATP-hydrolyzing)cycle because:A. glycogen synthase and phosphorylase are simultaneously activatedB. cyclic AMP activates adenylate kinase. C. when glycogen synthase is inactivated, phosphorylase is simultaneously activated. D. glycogen binds Mg2+, thereby lowering the concentration of MgATP2-Which of the following statements concerning gluconeogenesis is NOT true? a. Gluconeogenesis is to make glucose from glycogen. b. Many of the reactions of gluconeogenesis are glycolytic reactions going in reverse. c. The process of gluconeogenesis consumes ATP. d. The process of gluconeogenesis is regulated by ATP. e. Gluconeogenesis maintains the blood glucose level long after all dietary glucose has been absorbed and oxidized.A deficiency in sorbitol dehydrogenase cause all of the following except: Select one: O a. pathologic alternations related to Diabetes mellitus b. no lactose synthesis O c. lack of sperm motility O d. no fructose synthesis