A protein has the amino acid sequence DSRLSKTMYSIEAPAKLDWEQNMAL How many peptide fragments would result from cleaving the sequence with each reagent. cyanogen bromide: 3 trypsin: 4 chymotrypsin: 3 Incorrect Which of these three reagents gives the smallest single fragment (in number of amino acid residues)? Otrypsin cyanogen bromide Ochymotrypsin Incorrect

A protein has the amino acid sequence DSRLSKTMYSIEAPAKLDWEQNMAL How many peptide fragments would result from cleaving the sequence with each reagent. cyanogen bromide: 3 trypsin: 4 chymotrypsin: 3 Incorrect Which of these three reagents gives the smallest single fragment (in number of amino acid residues)? Otrypsin cyanogen bromide Ochymotrypsin Incorrect

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Similar questions

A tetradecapeptide (14 amino acid residues) gives the following peptide fragments on partial hydrolysis. From this information, deduce the primary structure of this polypep- tide. Fragments are grouped according to size. Pentapeptide Fragments Tetrapeptide Fragments Phe-Val-Asn-Gln-His Gln-His-Leu-Cys His-Leu-Cys-Gly-Ser His-Leu-Val-Glu Gly-Ser-His-Leu-Val Leu-Val-Glu-Ala
Write the chemical structure of peptide containing the following amino acid PRO-SER-GLY-LEU I NEED IT ASAP PLEASE
Which of the following amino acids would you least expect to find on the surface of a water-soluble protein? Explain I Serine Glutamat Lysime Threonine
Draw peptide Pro-Ser-Ala-Phe-Glu as you would see it at pH 7. Include stereochemistry.
A peptide has the sequence Glu-His–Trp–Ser-Gly–Leu-Arg-Pro–Gly The pK, values for the peptide's side chains, terminal amino groups, and carboxyl groups are provided in the table. Amino acid Amino pKa Carboxyl pKa Side-chain pKa glutamate 9.60 2.34 4.25 histidine 9.17 1.82 6.00 tryptophan 9.39 2.38 serine 9.15 2.21 glycine 9.60 2.34 leucine 9.60 2.36 arginine 9.04 2.17 12.48 proline 10.96 1.99 Calculate the net charge of the molecule at pH 3. net charge at pH 3:
Indicate which of the amino acid residues in the following peptide sequence contains a group that has a positive charge for its most likely charge state at pH 10. Asp-Tyr-Lys-GIn-Thr-Ile-Phe-Met-Ser (If none of the amino acids fit the criterion, select "none".) Asp Tyr ооооооооо Lys Gln Thr lle Phe Met Ser none
Write the chemical structure of peptide containing the following amino acid PRO-SER-GLY-LEU
Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA
Given the following sequence present within a large, soluble, globular protein: N-Asn Tyr Ser His Gly Asp Arg Tyr Thr lle Leu Leu Met Glu His Glu Phe Ile Val Pro Gly Pro Phe Thr Val Glu Val Asn -C What secondary structural elements are most likely present in this sequence? Please annotate the sequence to show where these structures begin and end.
A peptide has the sequence Glu-His-Trp-Ser-Gly-Leu-Arg-Pro-Gly The pK₁ values for the peptide's side chains, terminal amino groups, and carboxyl groups are provided in the table. Amino acid Amino pKa Carboxyl pKa Side-chain pKa glutamate 9.60 2.34 4.25 histidine 9.17 1.82 6.00 9.39 2.38 9.15 2.21 9.60 2.34 9.60 2.36 9.04 2.17 10.96 1.99 tryptophan serine glycine leucine arginine proline Calculate the net charge of the molecule at pH 3. Calculate the net charge of the molecule at pH 8. 12.48 net charge at pH 3: net charge at pH 8:
The peptide below -NH-CH- H3N-CH- CH3 NH-CH- -NH-CH- -O- -NH-ÇH- CH2 CH2 CH2 HN-ç=NH, NH2 CH2 CH2 CH Ho-CH, C-OH H,C CH3 needs to be separated from a second peptide with a primary sequence ADES. At what pH range would it be possible to separate the peptides? O 0- 2.0 O 2.5 - 3.5 O 4.0 - 9.0 O 13.0 -14.0 о 10.0-12.0
A mixture of Aspartic Acid (pl 2.98), Histidine (pl 7.59), Lysine (pl 9.74), Phenylalanine (pl 5.48) and Threonine (pl 6.53) are separated by cation exchange chromatography. What is the order of elution of these amino acids if you use gradient buffer system from pH 10 to pH 2. v First 1. Aspartic Acid v Second 2. Histidine v Third 3. Lysine 4. Phenylalanine v Fourth 5. Threonine v Fifth 6. No separation