5) Interpreting Data: For the following question, consider the table and graph presented below. p24 pg/ml B10? A V3 amino acid sequence molecular clone 296 306 317 320 324 charge* SI phenotype** 10 168.1 CTRPNNNTRKSIHIGPGRAFYATGDIIGDIRQAHC 3+ 168.10 6+ Mutagenesis set 10° X. 168.1/RT 4+ * *** ...- 168.1/RQ --Q-- 10 5+ 168.1/RN -R- -N------ 5+ 168.1/RTQ 5+ 103 + .--- 168.1/RTN T---N------ 5+ + 168.1/RON -0---N------ 6+ 102 10 2 4 6 10 12 14 days after transfection Table SEQ Table * ARABIC 3 and Graph 2 All the lines on the graph represent the effect of one molecular clone. What molecular clone does line X lescribe? How did come to such a conclusion? Answer: Line X is Molecular clone is the negative control group. We came to this conclusion because the egative control groun is the only one with 3+ charợe and a negative SI phenotype
5) Interpreting Data: For the following question, consider the table and graph presented below. p24 pg/ml B10? A V3 amino acid sequence molecular clone 296 306 317 320 324 charge* SI phenotype** 10 168.1 CTRPNNNTRKSIHIGPGRAFYATGDIIGDIRQAHC 3+ 168.10 6+ Mutagenesis set 10° X. 168.1/RT 4+ * *** ...- 168.1/RQ --Q-- 10 5+ 168.1/RN -R- -N------ 5+ 168.1/RTQ 5+ 103 + .--- 168.1/RTN T---N------ 5+ + 168.1/RON -0---N------ 6+ 102 10 2 4 6 10 12 14 days after transfection Table SEQ Table * ARABIC 3 and Graph 2 All the lines on the graph represent the effect of one molecular clone. What molecular clone does line X lescribe? How did come to such a conclusion? Answer: Line X is Molecular clone is the negative control group. We came to this conclusion because the egative control groun is the only one with 3+ charợe and a negative SI phenotype
Human Heredity: Principles and Issues (MindTap Course List)
11th Edition
ISBN:9781305251052
Author:Michael Cummings
Publisher:Michael Cummings
Chapter13: An Introduction To Genetic Technology
Section: Chapter Questions
Problem 20QP: Analyzing Cloned Sequences A base change (A to T) is the mutational event that created the mutant...
Related questions
Question
please asap
Expert Solution
This question has been solved!
Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.
This is a popular solution!
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Recommended textbooks for you
Human Heredity: Principles and Issues (MindTap Co…
Biology
ISBN:
9781305251052
Author:
Michael Cummings
Publisher:
Cengage Learning
Human Heredity: Principles and Issues (MindTap Co…
Biology
ISBN:
9781305251052
Author:
Michael Cummings
Publisher:
Cengage Learning