0.5 M NaOH. Write the acid base reaction that is taking place and use an ICE table to show how the number of moles of each species changes. What is the final pH of the buffer solution? (The pK of acetic acid is 4.7.)
Q: Which of the following properties of lipids makes it hard to digest? (A) Their molecules need an…
A: Lipids are a group of biomolecules that includes oils, fats, steroids and phospholipids. It acts as…
Q: 28.Explain the purpose of bile acids and fatty acid-binding proteins in the digestion and absorption…
A: Bile acids and fatty acid-binding proteins digest and absorb lipids. Bile acids, synthesized in the…
Q: Enzymes are biological catalysts that enhance the rate of a reaction by: stabilizing the transition…
A: Biochemical reactions tend to be slow because biomolecules are stable at biological pH and…
Q: A hypotonic solution is one that adds water to the cell. A hypertonic solution removes water from…
A: Cellular biology depends on the delicate dance of water and solutes across cell membranes. Solutions…
Q: DNA sense or template DNA sense or template mRNA tRNA protein 5', 3' amino or carboxyl 5' T U A A RG…
A: The genetic information for protein synthesis is stored in DNA. DNA is double-stranded. The…
Q: Which residue of phenylalanine hydroxylase is phosphorylated? A. Met18 B. Ser16 C. Ser12 D. Tyr24
A: C. Ser12Serine 12 is the residue of phenylalanine hydroxylase that is phosphorylated, and this…
Q: Please answer Discuss if you could perform the PCR and then agarose gel electrophoresis using a…
A: DNA is amplified and analyzed using molecular biology methods like PCR and agarose gel…
Q: In the following pathway for conversion of glc-6-p to pyruvate, what is compound X?…
A: Glucose 6-phosphate is converted to pyruvate by a metabolic process called glycolysis. Specifically,…
Q: - Lactose is a sugar found in milk and other dairy products. Explain how it is broken down in most…
A: Since you have posted multiple questions, we will provide the solution only to the first question as…
Q: Given the following reactions or reaction conditions, determine which are spontaneous. Choose one or…
A: In thermodynamics, the spontaneity of a reaction is determined by the Gibbs free energy change (ΔG).…
Q: 6. A quantitative amino acid analysis reveals that bovine serum albumin (BSA) contains 0.58%…
A: Amino acids, such as glycine, tryptophan, and alanine are organic molecules that contain an amino…
Q: The pK₂ of the x-carboxyl group of serine is 2.21, and the pKa of its a-amino group is 9.15.…
A: pKa is the pH at which a weak acid is 50% dissociated. % ionisation of a weak acid = % ionisation of…
Q: 14. Why does the brain consume energy even when resting?
A: Our brains are complex and active, controlling our thoughts, emotions, and bodily functions. Even at…
Q: 2. A. If 100 mls of 0.03 M HCI is added to 400 mls of 0.5 M glycine buffer at pH 10.4, what is the…
A: The pH of our glycine buffer is 10.4. At this pH, it will be the alpha-amino group of glycine (that…
Q: +40mV -70mV 2 3₂ OmV 4 ich concet Resting Potential 2 froar points to the dupy Time…
A: Electrical signals are how neurons communicate. Electrical signals are generated when there is a…
Q: If a cell has an adequate supply of adenine nucleotides but requires more guanine nucleotides for…
A: Cellular energy and signaling activities depend heavily on adenine nucleotides. Precursor chemicals…
Q: Which of the reactions are spontaneous (favorable)? L-malate + NAD+ oxaloacetate + NADH + H+ AG =…
A: Gibbs free energy change (ΔG) is a thermodynamic quantity that represents the maximum reversible…
Q: Supposed you want to use phosphoglucomutase to breakdown glycogen. You found out that this enzyme is…
A: Protein-based biomolecules belong to the class of enzymes. They speed up chemical reactions. Enzymes…
Q: Draw a diagram of the tetrapeptide Asn-Trp-Met-Ala (show all side chains and draw all peptide bonds…
A: Amino acids are the building blocks of proteins. A peptide bond is formed between the carboxy…
Q: Q. What would the reverse primer's sequence like if it were intended to bind the area of the DNA…
A: The reverse primer binds to the DNA template's complementary strand from 5' to 3'. If the DNA…
Q: 165. Explain why the direction of movement of fluid in the manometer was different during yeast…
A: Respiration, the fundamental process by which living organisms generate energy, has revealed…
Q: What protein has the code 6JX7 in the protein data bank? protein A. membrane B. spike protein C.…
A: The Protein Data Bank (commonly referred to as PDB) is an open access database containing…
Q: Use the two Fischer projections shown below to draw the Haworth projection of these two sugars…
A: Carbohydrates are poly hydroxy aldehydes or ketones. They can be classified as monosaccharides,…
Q: Based on your knowledge of how living organisms can do this chemistry list the cofactor or subclass…
A: Fatty acids metabolism involves β-oxidation. In β-oxidation, the fatty acids are oxidized on the β…
Q: Eukaryotic cells contain many compartmentalized organelles. Label each organelle in this eukaryotic…
A: The cell is the basic unit of life. It is made up of many smaller structures called organelles.…
Q: xplain the structure and components of a typical URI. Provide examples of common URI schemes.
A: A URI (Uniform Resource Identifier) is a string of characters that uniquely identifies a resource…
Q: BIOMOLECULES - MULTIPLE CHOICE - Please answer properly QUESTION : Which of the following best…
A: Enzymes are catalysts derived from biological sources. Biological systems rely on them to expedite…
Q: Q. Define signal transduction and explain the basic components of a signal transduction pathway.
A: Cells perceive external stimuli and respond intracellularly through signal transduction. It's…
Q: 55. what is the difference between the BIGpharma and biopharma
A: Biopharma and Big Pharma comprise the pharmaceutical industry. Biopharma develops biologics from…
Q: Which of these amino acids is an acidic amino acid? (Select all that apply, if necessary.) A. B. C.…
A: Amino acid which contains more number of acid group (-COOH) than amine group (-NH2) in its…
Q: Some of the first vaccines against COVID-19 are based on RNA molecules that code for the production…
A: An mRNA vaccine is a type of vaccine that uses a copy of RNA (mRNA) to produce an immune response.…
Q: 2. Draw the condensed structural formula for the triacylglycerol made from 3 saturated fatty acids…
A: In saturated fatty acids, all the carbon-carbon bonds are single bonds, and each carbon atom is…
Q: Information about poison
A: Poisons are toxic substances or chemicals which interfere the biological process and lead to failing…
Q: A buffer solution is composed of 1.00 mol of acid and 1.75 mol of the conjugate base. If the p pH of…
A: The pH of a buffer solution is determined by the balance between the concentration of the weak acid…
Q: 3. The compound 5-hydroxymethyl furfural forms while heating or cooking sugar-containing foods. HO…
A: Fructose is a monosaccharide, a ketohexose, a poly hydroxy ketone made up of 6 carbons.Fructose can…
Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…
A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…
Q: Draw both a parallel and an antiparallel beta-sheet using a ribbon diagram and use arrows to show…
A: The different levels of structural organization in a folded protein are primary, secondary, tertiary…
Q: In the final step of glycolysis, identify the name of the enzyme that converts phosphoenolpyruvate…
A: Glycolysis is a metabolic pathway consisting of a sequence of enzymatic activities. It facilitates…
Q: - Multiple choice Allopurinol is an inhibitor of xanthine oxidase. Administration of allopurinol to…
A: Xanthine oxidase is inhibited by allopurinol. This enzyme is involved in the conversion of xanthine…
Q: The standard reduction potential for (NAD+/NADH) is -0.320 V and the standard reduction potential…
A: a. The standard free energy change (ΔG°) for the Lactic acid dehydrogenase reaction is -26 kJ/mol.d…
Q: 3.16. Decarboxylation of glyoxalate (S) by mitochondria is inhibited by malonate (I). Using the…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: 32. What is the difference between maltose and sucrose?
A: Maltose and sucrose are two different kinds of disaccharides, which are composed of two connected…
Q: There are organisms that can fix atmospheric nitrogen and convert it into ammonia. Which enzyme do…
A: The conversion of atmospheric nitrogen to ammonia is called nitrogen fixation. Nitrogen fixation is…
Q: You are given a pure protein sample to characterize and provided the following information: Its…
A: 1(A)Beer-Lambert Law is often used in spectrophotometry to quantitatively analyze the concentration…
Q: A suspension of which of the following is most likely to form a liposome? i. Fatty acids ii.…
A: Liposomes are microscopic vesicles composed of lipid bilayers, which are similar in structure to the…
Q: How do you account for the differences in the amounts of proteins, lipids, carbohydrates, and…
A: Understanding the complex balance of proteins, lipids, carbohydrates, and nucleic acids in a…
Q: The ionization of p-nitrophenol is shown below (pKa = 7.0): a. Identify the weak acid and conjugate…
A: Since you have posted multiple questions with multiple sub parts, we will provide the solution only…
Q: Q) You are following the metabolism of aspartate that is equally labeled on all 4 carbons. Following…
A: In the first turn of the TCA cycle, the labeled oxaloacetate resulting from aspartate metabolism,…
Q: band marked with * scored positive for this activity. pH 9 TH pH 3 Decreasing pH )) If you perform…
A: The isoelectric point of a peptide is the pH at which the net charge on a peptide is zero. In…
Q: You put some Saccharomyces cereviciae stock concentration in a hemocytometer and count the 1/25mm^2…
A: 1.Calculate the average count:(12 + 23 + 34 + 16 + 14 + 2) / 6 = 101 / 6 ≈ 16.83Round this to the…
Please show thorough work/answers with explanations
![2. Making a buffer solution. Suppose you add 100 mL of a solution containing 5M of acetic acid to 400 mL of
0.5 M NaOH. Write the acid base reaction that is taking place and use an ICE table to show how the number of
moles of each species changes. What is the final pH of the buffer solution? (The pK of acetic acid is 4.7.)
a](/v2/_next/image?url=https%3A%2F%2Fcontent.bartleby.com%2Fqna-images%2Fquestion%2Fc687de40-2a04-4618-94c5-bffabbb64b83%2F2170cac6-868a-4fb6-90a5-a949ed8305a2%2F2l7rrai_processed.jpeg&w=3840&q=75)
![](/static/compass_v2/shared-icons/check-mark.png)
Step by step
Solved in 3 steps
![Blurred answer](/static/compass_v2/solution-images/blurred-answer.jpg)
- O b. False How much of ethanol you need to prepare 25% (v/v) ethanol solution Select one: O a. 75 ml O b. 75 g O c. 25 ml Od. 25 g The function of buffers is to Select one: ea Resist changes in pH. Ob. Fx the pH of solution Oc Resist changes in confugate acid .concentration d. Resist changes in weakacid .concentration1- Using the pH 12 of the buffer and the pKa = 12.32. What is the molar ratio of A- to HA. 2- What is the molar amount of A- and HA needed to prepare a 0.2 M buffer? 3- How many grams of A- and HA are needed to prepare 40 mal of the buffer? The molar mass of HA is 142g/mol The molar mass for A- is 380.1g/mol. An acetate/acetic acid (pKa=4.75) buffer of 500 mL includes 0.1 mol of acetate and 0.5 mol of acetic acid. 2.0 M NaOH was added to the buffer to get the pH to 4.70. What volume of NaOH was added to the system?
- An appropriate biochemical buffer should have charges in both its conjugate acid and conjugate base form. This avoids the presence of a neutral form of the buffer that might be able slowly leak into cells. Does unmodified dimethylpiperazine meet this criterion when buffering at pH 8? O Yes No What about buffering at pH 4? D Yes NoBe sure to answer all parts. Tris [tris(hydroxymethyl)aminomethane] is a common buffer for studying biological systems. (K, = 5.01 x 109 and pk, 8.3) %3D %3D (a) Calculate the pH of the Tris buffer after mixing 10.5 mL of 0.20 M HCI solution with 25.0 mL of 0.10 M Tris. 7.06 (b) This buffer was used to study an enzyme-catalyzed reaction. As a result of the reaction, 0.00020 mol of H* was produced. What is the pH of the buffer at the end of the reaction? (c) What would be the final pH if no buffer were present?gnment.doc?_&d x True and False Assignment.doX true or false Any condition tha x content/enforced/21069983-BL_SCI_SNC2D1-7A_993734_2122Sem3/Activity3%20Assignm BIU A - A - 2. Identify the following bonds as ionic or covalent. a) NaF b) MgCl2 c) C6H1206 d) NO2 e) CaF2 f) LiF 3. Complete the following table. Electron transfer Lewis diagram Atoms to be bonded Li & CI !!!
- NaOH.2L X.02mol/L = .004 mol, H3PO4.8L X.15 mol/L = .12 mol H₂PO4 HPO4² + H+ .108 mol start A. If 200 mls of 0.02 M NaoH is added to 800 mls of 0.15 M phosphoric acid buffer at pH 8.2, what is the resultant pH? (pK1 = 2.1, Pk2=7.2, pk3=12.2) add .004 mol OH- end .012mol -.004 .008 mol pH= pka + log [A-]/[HA] = 7.2 + log.112/.008 +.004 .112mol pH=8.35 B. If the same amount of NaOH in part A is added to 800 mls of water, what is the resulting pH? .004mol/1L =.004 [OH-] pOH = 2.4, pH -11.67. · In the space provided, sketch a titration curve (pH vs H+ ions dissociated) of a phosphate buffer shown below. The pKa of H2PO4 is 7.0. H,PO, НРО, + 9. 8. 7 pH 3 1.0 0.5 H+ dissociated --> b. What is the effective buffering range of this acid? At what pH will you have 25% of the buffer in the form of H2PO4? с.Part I. For each of the following four questions: calculate and describe how the requested solution would be made. Please show all of your calculations. In all cases the diluent or solvent will be water. Also, assume the smallest volume you can accurately pipette is 1ul. (CaClh: Molecular weight = 111.0 - NaCl: Molecular weight= 58.44) 1. From a 3M CaCh stock solution, you need to make 600 ml of 9 mM CaClh. Indicate how you would make it. 2. You have a 20ul sample of DNA that you want to run in a gel. You are given 5X track dye; how much track dye do you add to your sample so that the track dye concentration in the sample is 1X? 3. You need to make 6 liters of 20% NaCl solution. Indicate how you wvould make it firom powdered NACI.
- Size Size Crude Anion Cation 2) Exclusion Exclusion Lysate Exchange Exchange 1 2 Total Protein Concentration 15.2 6.6 2 3.75 4.7 (mg/mL) Final Sample Volume 60 30 20 4 3 (mL) Enzyme Specific Activity 0.43 1.7 7.25 18.3 12.5 (units/mgprotein) Based on your protein purification sample data, in which of the purification steps in your protocol did you effectively purify your enzyme? Select all that apply. a) anion exchange correct b) cation exchange correct c) size exclusion 1 correct d) size exclusion 2More ratios. Through the use of nuclear magnetic resonance spectroscopy, it is possible to determine the ratio between the protonated and deprotonated forms of buffers. (a) Suppose the ratio of [ A- ]A I to [HA] is determined to be 0.1 for a buffer with pKar6.0.pKa = 6.0. What is the pH? (b) For a different buffer, 91974 suppose the ratio of [ A- ]lA J to [HA] is determined to be 0.1 and the pHpH is 7.0. In this case, what is the pKapKa of the buffer? (c) For another buffer with pKa=7.5PKa = 7.5 at pH 8.0pH 8.0, what is the expected ratio of [ A- ][A ] to [HA]? doYou need to make a protein buffer of: . • • 100 mM NaCl 25 mM Tris 8 5% w/v glycerol • 2 mM DTT Your stock solutions are: 5 M NaCl • 2 M Tris 8 • 70% w/v glycerol • DTT @ 154.25 g/mol How would you make a 1L protein buffer Solution? Show your work and describe.
![Biology: The Unity and Diversity of Life (MindTap…](https://www.bartleby.com/isbn_cover_images/9781305073951/9781305073951_smallCoverImage.gif)
![Biology: The Unity and Diversity of Life (MindTap…](https://www.bartleby.com/isbn_cover_images/9781337408332/9781337408332_smallCoverImage.gif)
![Biology: The Unity and Diversity of Life (MindTap…](https://www.bartleby.com/isbn_cover_images/9781305073951/9781305073951_smallCoverImage.gif)
![Biology: The Unity and Diversity of Life (MindTap…](https://www.bartleby.com/isbn_cover_images/9781337408332/9781337408332_smallCoverImage.gif)